(data stored in ACNUC1104 zone)

EMBL: FN667741.PE81

FN667741.PE81        Location/Qualifiers
FT   CDS_pept        90862..92403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0016"
FT                   /locus_tag="XBJ1_0085"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.5.3.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79236"
FT                   /db_xref="GOA:D3UY58"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79236.1"
FT                   /translation="MAMNRRDFISTTAALAGAGVLSSLLPTTSLLARTLTAADASAVNI
FT                   DQLRPTLLKDAQYRTSRLGLDPRIWNWHRDVAATAMPANYYEASLADWPAFGSFPIDQN
FT                   CEVVVIGGGLLGASTALHLAEAGVDVILVEKDNIGSGASGRNGGQMTPGIARWEAETML
FT                   EKLSPDEAKRLWRFASVEAMNLVDELRERYGFECDRKYGHITAAIHPGHMGPLVANADA
FT                   RRQLGDTAVKVIGPHELQERYVRSGIYHGANIDSIGGQVQPLALLRGLIYSFAKLGGRV
FT                   YDGTKVKGIRQDASSAVIETERGVIRASKAVVLGVHGSTEEFISGPSTTVPFFTYVAVT
FT                   PPLPVDIKELIPSDLPVYDTQLQIDYYRAVRDNRLLFGGQGTGNSWSSRDVNNYLLERI
FT                   RTVFPQLEKPELEYSWGGISDLTLNGATDARKSGDSVPVYMVHGWSGHGVAQTVRIGKA
FT                   ISDDLTERNHDFTMLTRIEHSSIPLGSYFSPVAIPLIKGALGVINTVNPADMVSF"
     atggcaatga acagaagaga ttttatctct actactgctg cccttgcagg ggcgggagtg        60
     ctttcatctt tacttcccac cacttctctg ctcgcccgga ctttaactgc ggccgatgct       120
     tcggctgtta atattgacca actccggccg acactgttga aggatgcaca gtacagaacc       180
     agccggttgg ggttggatcc gcgcatttgg aactggcata gagacgtggc tgccacagcc       240
     atgccagcca actattatga agcctctctg gctgattggc cggcttttgg aagctttccc       300
     atagaccaga attgtgaggt tgtggtcatt ggcggtgggt tgctgggggc ttccactgcg       360
     ctgcatcttg cagaagcggg tgtggatgtg attctggttg aaaaggataa cattggttcg       420
     ggagcctctg gccgtaatgg agggcagatg acccccggaa ttgcccgctg ggaagctgaa       480
     actatgctgg aaaaactttc acccgatgag gccaaacgtt tatggcgttt tgcatcggtt       540
     gaagcgatga atcttgtgga tgaactccgc gaacgttacg gttttgaatg tgatcgtaaa       600
     tatggtcata ttacagcagc gatacatccg ggtcatatgg ggccattggt ggctaatgcc       660
     gatgcccggc gccagctggg agatacggcg gtgaaggtta ttgggccaca cgaattgcag       720
     gaaaggtatg tgcgttcggg tatctatcat ggtgccaata tcgacagcat cggtggacag       780
     gttcagcctc tggcgctgct gcgaggccta atttatagct ttgctaaact gggggggcga       840
     gtttatgacg gcacgaaagt gaagggcatc aggcaggatg ccagcagcgc ggtcatagaa       900
     actgaacggg gagtcatcag ggcgagtaaa gccgtggtac tgggggtaca tggctccacc       960
     gaagagttta tctctggccc ttccactacc gtgccttttt tcacctatgt ggcggtaact      1020
     ccgccgttgc cggtggatat caaagagctg atcccgtcag atctgccagt ctatgataca      1080
     cagttacaga tagattatta tcgcgcggtg cgtgacaacc gcctgctgtt tggtgggcag      1140
     ggcaccggca attcctggtc atcgcgtgat gtgaacaact atttgcttga gcgtatcaga      1200
     accgtgtttc cacaactgga aaaacccgaa ttggaatact cttggggcgg gatcagcgat      1260
     ctgaccctga atggtgccac cgatgcccgc aaaagcggtg acagcgtccc tgtgtatatg      1320
     gtgcatggct ggagcggtca tggagtggcg cagacggttc gtattggcaa agccatcagc      1380
     gacgatctca ccgaacgcaa tcacgacttt accatgctta ctcgcatcga acactcgagt      1440
     attccgctgg gttcctattt ctctccggtg gctatcccat tgattaaagg cgctctgggg      1500
     gtgataaaca cagtgaatcc ggcagatatg gtttcgttct ga                         1542
//

If you have problems or comments...

PBIL Back to PBIL home page