(data stored in ACNUC1104 zone)

EMBL: FN667741.PE83

FN667741.PE83        Location/Qualifiers
FT   CDS_pept        complement(92787..93632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="XBJ1_0087"
FT                   /product="hypothetical protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79238"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79238.1"
FT                   /translation="MNRILNVCVALCLTMIPVEAVKADITAPIVYLEHVTPSVSLNING
FT                   KEVNRLSIDTGASGAFYLPRTVFDSIFSELNHRTTTVQNSIDVFGVEKSAVTARASHIT
FT                   VNGERLSDVNVEIFKTWGNGGMLDDNGQLIINGVLGLGVAKNKTLIINYASKMLTIADH
FT                   LKALPDGYRWQSIPFTRTRNGIEISVSSGNEKIRRMVIDTGASHTMLFTRSKEGCAKLS
FT                   QHCPKKAIVTPDGVKLSAFLFQIPDERIDFDGLLGDDFLSNRVLIISNDRLLISLPNNS
FT                   "
     atgaatagaa tcctgaatgt atgcgtggcg ttgtgtctta caatgattcc agttgaagca        60
     gtaaaggcag atattactgc gccgattgtt taccttgagc atgtcactcc ttctgtttcg       120
     ctcaatatca atggtaaaga agttaatagg ctttcaattg atactggggc ttccggcgct       180
     ttttatctcc ctcgaaccgt ctttgattcg attttttcag agctaaacca tcgcacaaca       240
     accgtgcaaa attccattga tgtttttgga gttgagaagt ctgctgtaac ggcaagagca       300
     tcccatatta ctgttaatgg tgaacgcctt tcagatgtta acgttgaaat tttcaaaacg       360
     tggggtaacg gcggtatgtt agacgacaac ggacaactta tcataaatgg agtgctaggg       420
     ctgggtgtcg ccaaaaacaa aacgcttatt atcaactacg cttcaaagat gctgacgata       480
     gctgaccatc ttaaagcgct tcctgatggc taccgctggc aatctatccc gtttacccgc       540
     acaaggaacg ggatagaaat cagtgtgtca tctggtaatg agaaaatacg tcgtatggtt       600
     attgatactg gcgcaagtca tacaatgctt ttcacgcgct caaaggaggg atgtgctaag       660
     ttatcgcagc actgcccgaa gaaagccatt gtgacgcctg acggtgttaa gctctctgcg       720
     tttctctttc aaattccaga tgaacggata gattttgatg gcctgttagg cgatgacttt       780
     ctttcaaaca gagttcttat catatcgaat gatcgattgt taattagctt gcctaataac       840
     agttaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page