(data stored in ACNUC1104 zone)

EMBL: FN667741.PE90

FN667741.PE90        Location/Qualifiers
FT   CDS_pept        complement(102838..103164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0018"
FT                   /locus_tag="XBJ1_0094"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79245"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79245.1"
FT                   /translation="MRYTLFMLLILSPLSLAASFDCAKAKVPDEKAICTDHRLNDLDIE
FT                   MSVKYHFLRGLFAMGMSGEMYDSQQAWLKQRQKCKGDKTCLLQRYHQRINQLDAIYNSI
FT                   QKPI"
     atgagatata cattatttat gctgcttatt ctgtctcctc ttagtttggc tgccagtttt        60
     gactgtgcaa aagccaaggt accagatgaa aaagcaatct gtactgatca ccggcttaat       120
     gatctggata tagaaatgag cgtcaaatat catttcctac gagggttatt tgctatgggc       180
     atgtcgggtg aaatgtatga cagccaacag gcttggctga aacaacgcca gaaatgcaaa       240
     ggcgataaga catgcctgct acaacgttat caccagcgta ttaaccagct tgatgcaatt       300
     tataactcaa tccagaagcc gatatag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page