(data stored in ACNUC1104 zone)

EMBL: FN667741.PE91

FN667741.PE91        Location/Qualifiers
FT   CDS_pept        complement(103165..103509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0018"
FT                   /locus_tag="XBJ1_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79246"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79246.1"
FT                   /translation="MTDKSAVKEVESWSDTKKVAEFICRPLALSVIQQEHKEADKVFLG
FT                   DESPNSIRLVDSHLIGTGMYRQGFGWKNIRFSCELDPKTGEARSFKLLKALPPQLQTGP
FT                   EPVILPKKGE"
     atgacagata aatcagcggt caaagaggta gaaagctggt cagatactaa aaaagtagcc        60
     gagtttattt gcaggccttt agcactctct gttattcaac aagagcacaa agaggctgac       120
     aaagtgtttc tcggtgatga atcgccaaac agtatcagat tggttgattc ccacctcata       180
     ggtacaggga tgtatcgcca aggatttggc tggaaaaata tcagattctc ctgtgagtta       240
     gatcccaaaa ccggcgaagc gcggtcattc aaattgttaa aagcattacc accacaatta       300
     cagaccgggc cagagccggt gatccttcct aaaaaagggg agtag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page