(data stored in ACNUC1104 zone)

EMBL: FN667741.PE99

FN667741.PE99        Location/Qualifiers
FT   CDS_pept        111135..111977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0020"
FT                   /locus_tag="XBJ1_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79254"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79254.1"
FT                   /translation="MSRFIISRNNKSLLNETVFYLTKGNMLTLKIDGLNSNTKRHLKFQ
FT                   SNNTLVSIFQRDNYLFREQSLQITALNMGVSVVRAVDTDIDYCPYFAAGVAEDCFPPLT
FT                   IHVLSKISIPTDLTAEQKAILMVLLAETTTPETPGIKYDEKKAKDVMQYMHDVLLNRVR
FT                   SPKAHELDVPSQGNKLIGLISGARTIEGFSQYPNIKSDIKDRINGMIIAANEGSNSNFL
FT                   AYRRLIKNAIDIAKSNKISNTEIIAWRTKSTDSPGSNFIKLFSLQGQDFYKLSDSYLK"
     atgtctagat ttattatcag tcggaacaac aagtctttac ttaatgaaac cgtattctat        60
     cttacgaaag ggaatatgct tacattaaag atagatggtt tgaatagtaa tacaaaaaga       120
     catcttaaat ttcagtcgaa taatacgctt gtgtccattt ttcaacgtga taattatctg       180
     tttagagagc aaagcttgca aataacagct cttaatatgg gagtaagcgt ggttagagcg       240
     gtggatactg atatagatta ctgtccctat tttgcagcag gtgtcgctga ggattgtttt       300
     ccaccattaa caattcatgt cttatccaaa atatcgattc caacggactt aactgccgag       360
     cagaaagcga ttttaatggt gttgttagcg gaaacgacaa cgcctgagac accgggaata       420
     aagtatgatg aaaaaaaagc taaagatgtt atgcaatata tgcatgatgt tctattgaac       480
     agagtccggt ctcctaaagc acatgagctt gatgtgccca gtcaggggaa taaattaatc       540
     ggattaattt caggagcacg gacaatagaa ggttttagtc aatatcccaa tattaaatct       600
     gatataaaag atagaattaa cggtatgata atagctgcga acgaaggtag taattcaaat       660
     tttttagctt atcgacggtt aattaaaaat gctattgata tagccaaaag taataaaatc       720
     tctaatacag agattattgc atggagaacg aaaagtactg attctcctgg ctcaaatttt       780
     atcaagctat tttcattaca aggacaagat ttttataagc tatctgatag ttatcttaaa       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page