(data stored in ACNUC1104 zone)

EMBL: FN667741.PITA

FN667741.PITA        Location/Qualifiers
FT   CDS_pept        95583..97073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pitA"
FT                   /locus_tag="XBJ1_0089"
FT                   /product="low-affinity phosphate transport protein (PiT
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79240"
FT                   /db_xref="GOA:D3UY62"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79240.1"
FT                   /translation="MLHLFTGLDFYTSLMLVLALLFVLFYEAINGFHDTANAVATVIYT
FT                   RAMRSQFAVVMAGVFNFLGVLLGGLSVAYAIVHLLPTDLLLNVSSTHGLAMVFSMLLAA
FT                   IIWNLGTWYFGIPASSSHTLIGSIIGIGLTNAIVADSSVVDALNISKMIQIFMSLILSP
FT                   LVGLVIAGAMVFLLRRYWSGTKKRRRIHMTPAEREKQDGKRKPPFWTRTALILSAVGVS
FT                   FSHGANDGQKGIGLIMLVLIGVAPAGFVVNMNSTSYDITRTHDAVASLQKYYVQHGPAL
FT                   SHAIEQTPAVSSVEDSADQMLHCDSSQAQDVLNTAAVMLGSIQNFSELTPDQRNNMRRM
FT                   LMCAADTASAVAKLPETSLEDARFLNKLRKDLLNTVEYAPMWIIIAVALALSLGTMVGW
FT                   KRVAVTIGEKIGKKGMTYAQGVSAQVTAAVSIGVASYTGMPVSTTQVLSSAVAGTMLVD
FT                   GGGVQSKTIKNIMLAWVLTLPISIGLSGILYWIALQLI"
     atgctacatc tgtttactgg cctggatttt tataccagcc taatgttagt acttgctctg        60
     ttgtttgtgc ttttctatga agccatcaat gggtttcatg ataccgcaaa tgcagtagca       120
     actgttattt atacccgcgc gatgcgttcg cagtttgccg ttgtcatggc aggggttttt       180
     aactttttgg gtgttctcct tggtgggtta agtgtcgctt atgcgattgt acatctattg       240
     cctacagatc ttctgttaaa tgtcagttct acccacggct tggcgatggt tttctccatg       300
     ctgttggcgg caattatctg gaatttgggc acatggtatt tcggcattcc ggcatccagc       360
     tcccatacgt tgattggttc cattatcggc atcggcctga ccaatgcgat agtggccgat       420
     tcttcggtag ttgatgcgct gaatatctcc aagatgatac agattttcat gtccttgatc       480
     ctgtctcctc tcgtgggttt ggtgattgct ggagcgatgg tatttttact gcgccgttac       540
     tggagtggta ctaaaaaacg tcgtcgtatc catatgacgc ctgctgaacg tgaaaaacag       600
     gatggtaaac gtaaaccccc attctggaca cggactgcgc tgattctttc tgctgtaggg       660
     gttagtttct cccacggtgc aaatgatggg cagaagggta tcggcttgat catgcttgtg       720
     ctgataggtg tcgcgcctgc cggcttcgtg gtcaatatga actcaacgag ctatgacatt       780
     acccgtaccc atgatgcagt tgcttctttg caaaagtatt atgtgcagca cggcccggca       840
     ctttcccatg ctattgagca gactccggca gtgtcttcgg tagaagattc ggcggatcag       900
     atgctccatt gcgacagctc acaagcgcag gatgtgctga atacggctgc tgtgatgctg       960
     ggaagtattc agaacttcag tgagttgacc ccagatcaac gtaacaatat gcgccgtatg      1020
     ttgatgtgcg ctgctgatac ggcaagcgct gtggctaaat tgcctgaaac cagtcttgaa      1080
     gatgcccgtt tcctgaataa attacgcaag gatttgctga ataccgttga atatgccccg      1140
     atgtggatca tcattgctgt ggcacttgcc ttgtctctgg gcacaatggt aggttggaag      1200
     cgtgttgctg ttaccatcgg tgaaaaaatt ggcaaaaaag gcatgaccta tgctcaaggt      1260
     gtttctgctc aggtcacggc tgccgtttcc atcggggttg ccagttatac ggggatgcca      1320
     gtgtctacga cacaggtact ctcttctgcg gtagcaggta cgatgctggt tgatggtggt      1380
     ggtgttcaaa gcaagaccat taagaacatc atgctggcgt gggtactaac attacctatt      1440
     tcaattggat tatcaggcat tttgtattgg attgctctgc aactgatcta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page