(data stored in ACNUC1104 zone)

EMBL: FN667741.POTA

FN667741.POTA        Location/Qualifiers
FT   CDS_pept        470128..471243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0091"
FT                   /gene="potA"
FT                   /locus_tag="XBJ1_0471"
FT                   /product="spermidine/putrescine transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79620"
FT                   /db_xref="GOA:D3UWB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79620.1"
FT                   /translation="MTENTSLTPLVELNTLSKGFDGKQVISQLDLIINDGEFLTILGPS
FT                   GCGKTTVLRLIAGLEDADSGKILLEGQDITDIPAEHRHVNTVFQSYALFPHMTVFENVA
FT                   FGLRMQKTPAKEIAPRVEEALRMVQLEEFAQRRPAQLSGGQQQRVAIARAVVNKPKVLL
FT                   LDESLSALDYKLRKQMQNELKALQRKLGITFIFVTHDQEEALVMSDRIVVMRDGYIEQD
FT                   GTPREIYEEPKNLFVARFIGEINIFDAKVQHRIDEQRIRADVEGHECDIFTSLPVTAGQ
FT                   ILKVLLRPEDLRVEEINHGEQVSGLVGYVRERNYKGMTLDSVVEMENGKMVMVSEFFNE
FT                   DDPDVDHSLNQKIAVTWVESWEVVLVDEEDA"
     atgactgaga atacctctct gacaccactc gttgaactaa acaccctgag taagggtttc        60
     gacggcaaac aagttatttc acagctcgat ctgattatca atgatggcga gttcctgacc       120
     attcttgggc catccggttg cggcaagacc actgtactcc gtctgattgc cgggctggaa       180
     gatgcggata gcggcaaaat tttattggaa gggcaggata ttactgatat tcccgccgag       240
     caccgtcacg ttaatacggt gttccaaagt tacgcgctgt tcccccatat gaccgtattt       300
     gaaaacgtcg cttttggatt gcgcatgcag aaaacaccgg caaaggagat tgccccgcgt       360
     gttgaagaag cgttgcgcat ggtgcagctt gaagagtttg cccagcggcg tccggctcag       420
     ctttctggcg gtcagcagca gcgcgtggcg attgcccgtg cggttgtgaa caagccgaaa       480
     gtcttgctgc tggatgaatc gctgtcggca ctcgactata agctgcgtaa gcagatgcaa       540
     aatgagttga aagcacttca gcgcaagctc ggcatcactt ttatcttcgt gacccatgat       600
     caggaagaag cgctggtgat gtcagaccgg atcgtggtca tgcgtgatgg gtacatcgaa       660
     caggatggca cgccgcgtga gatctacgag gagccgaaaa atctgttcgt tgcccgcttt       720
     atcggcgaaa tcaatatctt tgatgccaag gtgcagcatc gcattgatga gcagcggata       780
     cgcgctgacg tcgaaggcca cgaatgtgat attttcactt cgttgcccgt caccgccgga       840
     caaatactga aagtgttgct gcgcccagaa gatcttcggg tcgaagagat caatcatggc       900
     gagcaggtgt cgggtctggt tggttatgtg cgtgaacgta actacaaggg catgacgctg       960
     gattcggtgg tcgaaatgga aaatggcaaa atggtcatgg tgagcgaatt ctttaacgaa      1020
     gacgaccccg atgttgacca ctccctgaac cagaagatcg cggtcacttg ggtagaaagc      1080
     tgggaggttg tgctggtcga tgaagaagac gcgtaa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page