(data stored in ACNUC1104 zone)

EMBL: FN667741.PSTB

FN667741.PSTB        Location/Qualifiers
FT   CDS_pept        183264..184040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstB"
FT                   /locus_tag="XBJ1_0191"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79342"
FT                   /db_xref="GOA:D3UYG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79342.1"
FT                   /translation="MNKANDIAGSKIQVRDLNFYYGKFHALKNITLDIEQNKVTAFIGP
FT                   SGCGKSTLLRTFNKMYELYGEQRAEGEIILDDTNILTDKQDIALLRAKVGMVFQKPTPF
FT                   PMSIYDNIAFGVRLFEKLPRAEMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRL
FT                   CIARGIAIRPEVLLLDEPCSALDPISTGRIEELISELKSEYTVVIVTHNMQQAARCSDH
FT                   TAFMYLGELIEFSDTDTLFTTPRKKQTEDYITGRYG"
     atgaataagg ctaacgacat tgcaggaagc aaaattcagg tacgtgatct gaacttctat        60
     tacggcaaat ttcacgcgct gaaaaacatc acactggata tcgagcagaa taaggtgaca       120
     gcctttatcg gcccgtcggg gtgcggcaag tccacgttac tgcgcacttt caacaaaatg       180
     tatgaactgt atggcgaaca gcgggcagaa ggcgaaatta tcctggatga caccaatatt       240
     ctgaccgata aacaggatat cgccctactg cgtgccaaag tcggcatggt gttccaaaaa       300
     ccaacgccat tcccgatgtc catttatgac aatattgctt tcggtgtgcg tttgtttgag       360
     aaactgccaa gggctgaaat ggatgaacgc gtccaatggg cgctgacaaa agccgcattg       420
     tggaatgaga ccaaagacaa actgcaccag agtggttata gcctttccgg tggtcagcag       480
     cagcgtttat gcattgcccg tggtatcgcg atccgcccgg aagttttgtt attggatgaa       540
     ccgtgctcgg cacttgaccc gatctccacc ggacgcattg aagagttaat cagtgaattg       600
     aaatcggaat ataccgtggt gatcgtcacc cataacatgc agcaggccgc gcgctgttct       660
     gaccacactg catttatgta cctcggagag ttgatcgagt tcagtgacac agacacgctg       720
     tttaccacac ccagaaagaa acagactgaa gattatatta caggccgtta cggttga          777
//

If you have problems or comments...

PBIL Back to PBIL home page