(data stored in ACNUC1104 zone)

EMBL: FN667741.PSTC

FN667741.PSTC        Location/Qualifiers
FT   CDS_pept        181352..182308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstC"
FT                   /locus_tag="XBJ1_0189"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79340"
FT                   /db_xref="GOA:D3UYG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79340.1"
FT                   /translation="MAERKTALKAPSKNGDIIFSALVRLAALMTLFLLGGIIISLIIAA
FT                   WPSIKTFGFGFLWNKDWDAPAEQFGALVPIYGTLVTSLIALIIAVPVSFGIALFLTELA
FT                   PNWLKRPLGVAVELLAAIPSIVYGMWGLFVFAPLFATYFQQPVGDVLSSIPIVGELFSG
FT                   PAFGIGILTAGIILAIMIIPYIASVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPY
FT                   TKNGVIGGVMLGLGRALGETMAVTFIIGNTYQLDSLSLYMPGNSITSALANEFAEAESG
FT                   LHTAALMELGLILFVITFIVLALSKLMILRLAKNEGR"
     atggccgaac gtaaaacggc actgaaagca ccaagcaaaa atggcgatat tattttcagc        60
     gcactggtta gactagctgc gctgatgacg ttatttctgc tggggggcat tatcatttcg       120
     ctgattattg ctgcctggcc gagtatcaaa acttttggtt ttggttttct atggaacaag       180
     gattgggatg cgccggcaga gcaatttggc gcactggtgc cgatttatgg cacattggtg       240
     acctcactga ttgccctgat tattgccgtt cctgtgagtt ttggtattgc cctgtttttg       300
     acggaactgg cacctaactg gttgaaacgt ccgctgggcg tggcggttga actactggcc       360
     gcgatcccca gtattgttta tggcatgtgg gggctgtttg tctttgctcc tctgttcgcc       420
     acttatttcc agcaacctgt cggtgatgtg ctgtcgagta ttcccatcgt gggagaactg       480
     ttctccggcc cggcttttgg tatcggcatt ctgacggcag gcatcattct cgccatcatg       540
     attattcctt atatcgcttc cgttatgcgt gatgtgtttg agcaaacgcc ggtcatgatg       600
     aaggaatccg cctatgggat cggctgtaca acctgggaag tgatttggcg tatcgtcctg       660
     ccttacacca agaatggcgt gattggcggc gtcatgttgg ggcttggccg ggcgttgggg       720
     gaaacgatgg cggtgacctt tattatcggt aatacctacc aacttgacag tctctctctc       780
     tacatgccgg ggaatagcat tacgtccgcc ctggccaacg aattcgccga agcggaatcc       840
     ggcttgcata ccgcagcatt gatggaactg ggactgatcc tgtttgtgat cacctttatt       900
     gtgctggcgt tgtcgaaatt gatgatcctg cgtctggcaa agaatgaggg gcgctga          957
//

If you have problems or comments...

PBIL Back to PBIL home page