(data stored in ACNUC1104 zone)

EMBL: FN667741.PSTS

FN667741.PSTS        Location/Qualifiers
FT   CDS_pept        180218..181249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0039"
FT                   /gene="pstS"
FT                   /locus_tag="XBJ1_0188"
FT                   /product="high-affinity phosphate transport protein (ABC
FT                   superfamily, peri_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79339"
FT                   /db_xref="GOA:D3UYG1"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79339.1"
FT                   /translation="MRTTVASIMAAALAMTSLSSFAASSLTGAGATFPAPVYTKWADSY
FT                   QKETGNKINYQGIGSSGGVKQIIAHTVDFGASDAPLSHEKLEADGLFQFPTVIGGIVLA
FT                   VNISGIKSGQLVLDGKTLGDIYLGNIKKWNDPAITKLNPGLRLPDQNIAVIRRADGSGT
FT                   SFVFTSYLSKVNSLWKEKVGVGSTVKWPAGLGGKGNDGIAAFVQRLPGSIGYVEYAYAK
FT                   QNNLAYTKLISADGKVVAPTEANFSAAAKGADWSKSFAQDLTAQKGDNVWPITSTTFIL
FT                   IHKQQKNAANGIEVLKFFDWAYEQGGKQAKDLDYSVLPQDVIGQIRAAWKRDIKDSSGN
FT                   PLY"
     atgcgtacca ccgtggcaag catcatggca gcagcacttg ccatgacatc tctgtcttcg        60
     tttgctgctt ccagtctgac gggagcgggg gcgacattcc cggcaccggt atataccaag       120
     tgggcagatt cctatcaaaa agaaacgggc aataaaatca attatcaggg tattggctct       180
     tcgggtggtg tgaaacagat tattgcccat accgttgatt ttggtgcatc tgatgccccg       240
     ctttctcatg aaaaactcga agctgatggc ctgttccagt ttccaacggt gatcggtggc       300
     attgtgctgg ccgtgaatat ttctggtatt aaatccggcc agttggtctt ggatggcaaa       360
     accctcggtg acatttatct gggcaatatc aagaaatgga atgatccggc gattacaaaa       420
     ctgaatcccg gcctcagact ccccgatcag aatatcgccg tcattcgtcg tgcggatggc       480
     tctggtactt ccttcgtctt caccagctac ctgtccaaag tgaatagtct ctggaaggaa       540
     aaagtcgggg tgggttcgac ggttaaatgg ccggccggct tggggggcaa gggtaacgat       600
     ggcattgccg cgttcgtcca gcgtttgccc ggttccatcg gttatgtcga atacgcctat       660
     gcgaaacaaa ataacctcgc ttataccaaa ttgatttcgg cagacggcaa agtcgttgcg       720
     cctactgaag cgaatttcag tgctgcggcg aaaggggcgg attggagcaa aagtttcgct       780
     caggatctga cagcccagaa aggtgacaat gtgtggccga tcacttcaac gacttttatt       840
     ctgatccaca aacagcagaa aaatgcggcg aatgggattg aagtgctgaa atttttcgat       900
     tgggcttatg agcagggcgg aaaacaggcg aaagatctgg attattctgt cctgccgcaa       960
     gacgtcattg gacagatacg tgcagcatgg aagcgcgaca taaaagacag cagtggtaat      1020
     ccgctgtact aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page