(data stored in ACNUC1104 zone)

EMBL: FN667741.PYRB

FN667741.PYRB        Location/Qualifiers
FT   CDS_pept        complement(408918..409859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="XBJ1_0400"
FT                   /product="aspartate carbamoyltransferase, catalytic
FT                   subunit"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79550"
FT                   /db_xref="GOA:D3UZ22"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79550.1"
FT                   /translation="MANPLYRKHIISINDLSRTDLELVLQTAAALKANPQTELLKHKAI
FT                   ASCFFEASTRTRLSFETAIQRLGASVVGFADSNNTSLGKKGETLADTISIISQYTDAIV
FT                   MRHPQEGAARLASEFSGHIPVINAGDGANQHPTQTLLDLFTIQETQHKLDNLKIAMVGD
FT                   LKYGRTVHSLTQALAKFSGNHFCFIAPDALAMPSYILHMLDEKQVSYSIHHNFEDVMPE
FT                   LDILYMTRVQKERLDPSEYANIKAQFVLHAADLVNVKENLKVLHPLPRIDEITVDVDKT
FT                   PYAYYFQQAGNGIFARQALLALVLNENVVIEK"
     atggctaatc cgttatatcg caagcatatc atttcaatta atgatctgag tcgcacggat        60
     ctggaattgg tattgcagac ggcagcagca ttgaaagcca atccacagac tgaattacta       120
     aaacacaagg cgatcgcaag ctgctttttt gaagcctcta cacgcacccg cctctctttt       180
     gaaacagcca ttcagcgact cggcgcttcc gttgtcggtt ttgctgatag caacaatact       240
     tccttgggta aaaaagggga aacactggcc gataccattt ctattatcag ccagtatacc       300
     gatgcaattg tgatgcgcca tccacaggaa ggcgccgctc gtcttgcttc tgaattctcc       360
     ggccatattc ctgtcattaa cgccggtgat ggtgcaaacc agcacccaac ccagactctg       420
     ctcgatctgt tcaccattca agagactcaa cacaagctgg ataacctgaa aattgctatg       480
     gttggtgatt tgaaatatgg ccggactgtc cactcgttaa cacaggcact ggcaaaattc       540
     agcggcaacc atttctgctt tatcgccccg gatgctttgg ccatgccaag ctatatcctg       600
     catatgctgg atgagaagca ggtcagctac agcattcacc ataattttga agatgtcatg       660
     cctgaactgg atatcctcta tatgacccgt gtgcagaaag agcgtcttga cccttccgag       720
     tacgccaata tcaaagctca gttcgtgctg catgccgctg atctggttaa tgttaaagag       780
     aatttgaaag tgctgcatcc actgccacgt atcgatgaaa tcaccgtaga tgtcgataaa       840
     accccttatg cctactattt ccagcaggca ggtaacggca ttttcgcccg tcaggcattg       900
     ctggcactgg tattgaatga aaatgtcgtc atagaaaaat ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page