(data stored in ACNUC1104 zone)

EMBL: FN667741.PYRH

FN667741.PYRH        Location/Qualifiers
FT   CDS_pept        608455..609183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0118"
FT                   /gene="pyrH"
FT                   /locus_tag="XBJ1_0591"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79735"
FT                   /db_xref="GOA:D3UWG1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79735.1"
FT                   /translation="MATNAKPVYQRILLKLSGEALQGAEGFGIDASVLDRMAQEVKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAEAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRHGRVVIFSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVYSSDPAKDTEAVLYSKLTYQEVLERELKVMDLAAFTLARDHSIPIRVFNMNK
FT                   PGALRRVVMGESEGTLISHG"
     atggcaacca atgcaaaacc cgtatatcag agaatcctgc ttaagctcag tggagaagcc        60
     ctgcaaggcg cagaaggttt tggtatcgat gccagcgttt tagaccgcat ggctcaggaa       120
     gtcaaagaac tggttgagct gggtattcag gtcggtgtcg ttattggcgg aggtaacctg       180
     tttcgcggag ccggtctggc cgaagcagga atgaaccgtg tagtcggcga tcacatgggc       240
     atgttggcaa ccgtaatgaa tggcctggca atgcgcgatg ccttacaccg cgcctatgtg       300
     aacgctcgtt tgatgtctgc cattccactg aatggagtgt gtgacaatta tagctgggct       360
     gaagctatca gcttactgcg tcacggtcgt gttgttattt tctctgcagg tactggcaac       420
     ccattcttta cgacagattc cgcagcatgc ttgcgcggca ttgaaattga agcggatgtt       480
     gtgttaaaag caaccaaagt tgatggggtc tattctagtg atcctgctaa agatactgaa       540
     gctgttcttt acagtaagct cacttatcag gaagtactgg agcgtgaact gaaagtcatg       600
     gatctcgccg cctttactct ggctcgtgac catagtatcc caattcgtgt cttcaatatg       660
     aacaagccag gcgcacttcg tcgtgttgtg atgggggaaa gtgaaggtac gttgatttct       720
     cacggataa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page