(data stored in ACNUC1104 zone)

EMBL: FN667741.RPLU

FN667741.RPLU        Location/Qualifiers
FT   CDS_pept        361923..362231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="rplU"
FT                   /locus_tag="XBJ1_0355"
FT                   /product="50S ribosomal subunit protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79505"
FT                   /db_xref="GOA:D3UYX7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79505.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQTIRLEKLDIATGETVEFDQVLMVANGE
FT                   DIKIGAPVVEGVKVKAEVVAHGRGEKIKIVKFRRRKHSRKQQGHRQWFTDVKITGIA"
     atgtacgcag ttttccaaag tggtggtaaa caacaccgag taagcgaagg tcagacaatt        60
     cgcttggaaa agctggacat cgcaaccggt gaaactgttg agtttgacca ggttctgatg       120
     gtcgctaatg gtgaagatat taagatcggc gctccagtag ttgaaggcgt taaagttaaa       180
     gctgaagttg ttgctcatgg ccgtggcgag aaaattaaaa tcgttaagtt tcgtcgtcgt       240
     aaacacagcc gtaagcagca gggccaccgt cagtggttca ctgatgttaa aatcactggc       300
     atcgcttaa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page