(data stored in ACNUC1104 zone)

EMBL: FN667741.RPSR

FN667741.RPSR        Location/Qualifiers
FT   CDS_pept        341881..342108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0068"
FT                   /gene="rpsR"
FT                   /locus_tag="XBJ1_0331"
FT                   /product="30S ribosomal subunit protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79481"
FT                   /db_xref="GOA:D3UYV3"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79481.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIVTLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
     atggcacgtt atttccgtcg tcgcaaattc tgccgtttta cagcggaagg cgttcaagag        60
     attgattata aagacatcgt tacgctgaaa aactacatta ccgaaagcgg taaaattgta       120
     ccaagccgca ttaccggcac tcgtgcaaaa taccagcgtc agctcgctcg tgctatcaag       180
     cgtgcgcgct acctgtcttt gttgccttac actgatcgtc atcagtaa                    228
//

If you have problems or comments...

PBIL Back to PBIL home page