(data stored in ACNUC1104 zone)

EMBL: FN667741.TATA

FN667741.TATA        Location/Qualifiers
FT   CDS_pept        511157..511405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0100"
FT                   /gene="tatA"
FT                   /locus_tag="XBJ1_0509"
FT                   /product="twin-arginine translocase subunit,
FT                   sec-independent protein export"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79658"
FT                   /db_xref="GOA:D3UZ76"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79658.1"
FT                   /translation="MISIPQLLIIAVIVVLLFGTNKLRSLGSDLGASIKGFKKAISDDE
FT                   KSDQAEKNSHDADFDTKSIAEKSTVAEKSESKNKEQV"
     atgataagca tcccacaatt actcattatt gctgtcattg tcgtattgct atttggtacc        60
     aataagcttc gctctctggg ttcagacttg ggagcatcga tcaaaggttt taaaaaagcg       120
     ataagtgatg atgaaaagtc agatcaagct gagaaaaata gccatgatgc tgattttgac       180
     accaaaagta ttgctgaaaa gtccactgtt gccgaaaaat cagagagcaa aaataaagag       240
     caggtataa                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page