(data stored in ACNUC1104 zone)

EMBL: FN667741.TRKH

FN667741.TRKH        Location/Qualifiers
FT   CDS_pept        522650..524101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0103"
FT                   /gene="trkH"
FT                   /locus_tag="XBJ1_0521"
FT                   /product="potassium transport protein, requires TrkE (Trk
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79670"
FT                   /db_xref="GOA:D3UZ88"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79670.1"
FT                   /translation="MHFRAITRIVGLLVILFSVTMIIPGLVALIYRDGAGRAFSQTFIF
FT                   ALVIGLMLWVPNRNQKHDLKPKEGFLIVVLFWTVLGSVGALPFIFSEKPNLSVTDAFFE
FT                   SFSGLTTTGATTLIGLDSLPKAILFYRQMLQWLGGMGIIVLAVAILPLLGVGGMQLYRA
FT                   EMPGPLKDNKMRPRIAETAKTLWLIYVLLTIACAIALWAAGMSIFDAISHSFSTIAIGG
FT                   FSTHDASIGFFNSPAINTIIAIFLLISGCNFGLHFAVLSGRSLKVYWRDPEFRMFITIQ
FT                   LALLVICVLILWQQSIYESGLDALNHAFFQVVSMATTAGFTTVSFADWPLFLPFLLLCS
FT                   AFIGGCAGSTGGGLKVIRILLLFLQGSRELKRLVHPNAVYTIKLGQRALPERIIEAVWG
FT                   FFSAYVLVFLISMLLLIATGVDEFSAFSAIAATLNNLGPGLGAVSDNFTTMNPAAKWIL
FT                   VVTMLFGRLEVFTLLVLFTPTFWRE"
     atgcattttc gcgccataac ccgtattgtc gggctacttg tcattctttt ctctgtcaca        60
     atgattattc cgggattggt ggcattgatt tatcgagatg gcgcgggtag ggcattcagt       120
     cagacattta tctttgctct cgtgattggt ttaatgttat gggtgcctaa tcggaaccaa       180
     aagcatgacc ttaaaccgaa agagggtttt ttgatcgttg tcttgttctg gacagttctg       240
     ggaagtgtcg gtgcattacc tttcattttc tcagagaaac ctaacctttc agtgactgat       300
     gccttttttg aatcattttc aggcttgacg acaacagggg caactacact tattggtctc       360
     gattctctgc cgaaagctat cctcttctat cgacaaatgc tgcaatggct tgggggaatg       420
     gggatcatcg tattagctgt agcgattctg cccttgctcg gtgtcggggg aatgcagctg       480
     tatcgggcag aaatgccggg gccattgaaa gacaataaaa tgcgcccccg cattgcggag       540
     accgcaaaaa cactctggct gatctacgtc ttgctgacca ttgcctgtgc aatagcgtta       600
     tgggcggcgg gtatgtcgat attcgatgcg atttcccata gtttttctac aatcgcgatt       660
     ggtgggtttt cgacacatga tgccagcatc ggttttttca atagcccggc tattaatacc       720
     attattgcga ttttcctgct gatctctggc tgtaattttg gtttgcattt cgccgtactt       780
     tctggacgaa gtttgaaagt ttactggcgt gatccggaat tccgcatgtt cattactatc       840
     caattggcat tattggtgat ctgtgtgctg atattgtggc aacaatccat ttacgaatca       900
     ggattagatg cactgaatca tgctttcttt caagtggttt cgatggcaac cacggctgga       960
     tttacaacag tcagttttgc cgattggcct ctatttctgc cttttcttct cttatgttct      1020
     gcatttatcg gaggatgtgc gggatcgacg ggtgggggat taaaagttat ccgtatcttg      1080
     ttgttgttcc tgcaaggctc ccgtgaacta aaacgtctgg ttcacccgaa cgccgtatac      1140
     accattaaat tgggacaaag agcattgccg gaacgaatta ttgaagcagt gtggggtttc      1200
     ttctctgctt atgtgttggt ttttcttatt agcatgctgt tactgattgc aacaggcgtt      1260
     gatgagtttt ccgctttttc tgccatagcc gcaacattga ataacttggg gccagggttg      1320
     ggagccgtct ctgataactt taccaccatg aatccggcgg ctaaatggat attggtcgta      1380
     accatgctgt ttggacgttt ggaagttttc actctattag ttctgttcac accgactttt      1440
     tggcgtgaat aa                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page