(data stored in ACNUC1104 zone)

EMBL: FN667741.TSF

FN667741.TSF         Location/Qualifiers
FT   CDS_pept        607467..608324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0117"
FT                   /gene="tsf"
FT                   /locus_tag="XBJ1_0590"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79734"
FT                   /db_xref="GOA:D3UWG0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79734.1"
FT                   /translation="MADITAALVKELRERTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVILVEVAADAKYAGIVELNCETDFVAKDSGFLAFGKEVIAAVMA
FT                   DKNADIDALKAQFEEQRANLVAKIGENINIRRVTILEGDAVGSYLHGARIGVLVSAEGA
FT                   SEELIKHVAMHVAASKPEYVNPTDVPADVVAREHQIQMDIAMQSGKPREIAEKMVSGRM
FT                   NKFTGEISLTGQNFVMDPSKTVGDLMKENNAKVINFIRFEVGEGIEKVEADFAAEVAAM
FT                   SKQS"
     atggctgaca ttaccgctgc tctggtaaaa gaactgcgtg agcgtactgg cgcaggcatg        60
     atggaatgta aaaaagcact ggttgaagca aatggtgata tcgagctggc tatcgataac       120
     atgcgtaaat caggtcaggc aaaagccgct aagaaagcag gccgtgttgc ggctgaaggt       180
     gttattctgg ttgaagttgc agctgacgct aaatatgcgg gtattgttga actgaactgt       240
     gaaactgact tcgttgctaa agactctggc ttcctggcgt ttggtaaaga agtgattgct       300
     gccgttatgg cggacaaaaa tgctgatatc gatgcactga aagctcagtt cgaagaacag       360
     cgtgctaacc tggtagcgaa aatcggtgaa aacatcaata tccgtcgcgt tactattctg       420
     gaaggtgacg cagtaggttc ttacctgcac ggtgctcgca tcggtgttct ggtttccgct       480
     gaaggcgcaa gcgaagaact gatcaagcac gttgcaatgc acgttgctgc aagcaagcca       540
     gaatacgtga acccaactga cgttcctgct gatgtcgttg cgcgtgaaca ccagatccag       600
     atggatatcg caatgcaatc aggcaaaccg cgtgaaatcg cagagaaaat ggtttctggc       660
     cgcatgaaca aattcactgg cgaaatctct ctgacgggtc aaaactttgt gatggatcca       720
     agcaaaacgg ttggtgacct gatgaaagaa aataatgcta aagttatcaa cttcatccgt       780
     tttgaagtcg gtgaaggcat tgagaaagtt gaagctgatt tcgcagcgga agttgctgca       840
     atgagcaagc agtcttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page