(data stored in ACNUC1104 zone)

EMBL: FN667741.TYPA

FN667741.TYPA        Location/Qualifiers
FT   CDS_pept        222183..224006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="XBJ1_0224"
FT                   /product="GTP-binding elongation factor family protein with
FT                   P-loop containing NTP hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79375"
FT                   /db_xref="GOA:D3UYJ7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79375.1"
FT                   /translation="MSINNLRNIAIIAHVDHGKTTLVDKLLQQSGTFGERAATTERVMD
FT                   SNDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVMSMVDSVLLLVDAMD
FT                   GPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGATDEQLDFPI
FT                   VYASALMGIAGNEHTDMAEDMTPLYQAIVDHVEPPKVDLDGPFQMQISQLDYNNYVGVI
FT                   GIGSIKRGTVKPNQTITIIDSEGKTRNGKVGKVFSHLGLDRIESAQAEAGDIIAITGLG
FT                   ELSISDTLCDTSAVEALPALAVDEPTVSMYFCVNTSPFCGREGKYVTSRQILDRLRKEL
FT                   VHNVALRVEETEDPDAFRVAGRGELHLSVLIENMRREGFEMGVSRPKVIYREIDGRKQE
FT                   PFEQVTLDIEEQHQGDVMQALGERKGEMRDMLPDGKGRVRLDYSIPSRGLIGFRTEFMT
FT                   MTSGTGLLYATFSHYDDIRPGEIGRRQNGVMISNGQGKAVAYALYSLQDRGKLFLGHGT
FT                   EVYEGQIIGIHSRSNDLTVNCLTGKKLTNVRASGTDEATTLSPYLKKTLEQALEFIDDD
FT                   ELVEVTPQSIRLRKRHLTENDRRRANRGKEM"
     ttgtcaatta ataacttaag aaacatcgcc atcatcgctc acgtcgacca tggcaaaacc        60
     acgctggttg ataaactctt gcagcagtcg ggtacatttg gcgaacgcgc agcaacgact       120
     gagcgtgtaa tggattccaa tgatctggaa aaagagcgtg gcatcaccat tcttgcaaaa       180
     aacaccgcca ttaaatggaa tgattaccgt atcaacatcg tagacacccc aggccacgcc       240
     gactttggtg gtgaagtaga gcgtgtgatg tcaatggttg acagtgtgct gttgctggtt       300
     gatgcgatgg atggcccgat gccacaaact cgcttcgtaa cccagaaagc ctttgcccac       360
     ggcctgaaac ctatcgttgt tatcaacaaa gttgaccgtc ctggcgcacg tcctgactgg       420
     gtcgtcgatc aggtatttga cctgttcgtc aacttgggtg caactgatga gcaactggac       480
     ttcccgatcg tctatgcttc tgcactaatg ggtattgctg gtaatgaaca cacagacatg       540
     gcggaagaca tgaccccgct gtatcaggcg attgttgatc acgttgaacc gcctaaagtt       600
     gatctggatg gcccattcca gatgcaaatc tcgcagttgg actacaacaa ctatgttggg       660
     gttatcggca ttggcagtat taagcgtggt actgtaaaac caaaccagac catcaccatc       720
     attgacagtg aaggcaaaac ccgtaacggt aaagtcggta aagtcttcag tcatctgggt       780
     ttggatcgca ttgaatcagc tcaggcggaa gcaggcgaca ttattgcgat taccggtctg       840
     ggcgagttga gtatctctga tacgctgtgt gataccagtg ccgttgaagc tttgccagca       900
     ctggcggttg atgaacctac tgtcagcatg tacttctgcg taaacacctc acctttctgt       960
     ggtcgtgaag gtaaatacgt gacttcccgc cagatccttg atcgtctgag aaaagaactg      1020
     gtacacaacg tggcactgcg tgttgaagaa accgaagatc cagatgcatt ccgcgttgca      1080
     ggtcgtggtg aactgcacct gtccgtcctg attgaaaaca tgcgtcgtga aggcttcgag      1140
     atgggcgttt cccgtccaaa agttatttac cgtgaaatcg atggccgtaa gcaggaacca      1200
     ttcgagcagg taacactgga tatcgaagag caacatcagg gtgatgtgat gcaggctctg      1260
     ggtgagcgta agggcgaaat gcgtgacatg ctgccagatg gcaaggggcg tgtacgtctg      1320
     gattactcta ttccaagccg tggtttgatc ggcttccgta cagagttcat gaccatgact      1380
     tccggtacgg gtctgctcta tgcgacattc agtcattatg atgatattcg tccgggtgaa      1440
     atcggtcgcc gtcaaaacgg tgtgatgatt tctaacggtc agggtaaagc ggttgcttac      1500
     gcactgtata gtttgcagga tcgcggcaag ctgttcctcg gtcacggtac ggaagtttat      1560
     gaaggccaga ttatcggtat tcactctcgt tccaatgacc tgactgtgaa ctgcctgaca      1620
     ggtaagaaac tgaccaacgt tcgtgcatca ggaacagatg aagcaacgac actgtctcca      1680
     tatctcaaga aaacactgga gcaggcgctg gaatttatcg atgatgacga gctggttgaa      1740
     gtgactccac agtcgattcg cctgcgtaaa cgccatttga ctgaaaatga tcgccgtcgc      1800
     gcaaatcgcg gcaaagaaat gtaa                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page