(data stored in ACNUC1104 zone)

EMBL: FN667741.XHLB

FN667741.XHLB        Location/Qualifiers
FT   CDS_pept        complement(266234..267904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0053"
FT                   /gene="xhlB"
FT                   /locus_tag="XBJ1_0259"
FT                   /product="XhlB (TpsB protein)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15659065; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79410"
FT                   /db_xref="GOA:D3UYN2"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79410.1"
FT                   /translation="MIKKTAIFILLCTALQVKASPEELNVILPTDETRRTLQDSSREID
FT                   QLIEQRRHQGLVNRSGALSPQTVSPVLVEAPVCLDIRGVYLQGITLLTLTDLNTLSTLP
FT                   DNCITSNDINKLSAEITNLYIAKGYITARVQFIPPSHHGELGINVVEGFIEAIEGGDRW
FT                   INSRMLFPHLTNKPLNLSQLDQGLDQANRLQSNKATLDILPGKVNGGSVIRLSNQHSTP
FT                   WRISTITDNYGQKSTGKWISRLNASMDSPLGLSDFISLSGISTVDNPDTQYNRAATLFY
FT                   SLPYGAATFSGFTSYSRYISHPKLQHNVHKLYGNSQQSGMRMDWVFHRNQSQISTLNTQ
FT                   LVYKNFNNYFDSAKLSHSSQTLTVFSLGISHLQIIANGLITFDAGIEQGTPWFSAQTST
FT                   DNLNKQFTKGKLSVNLQQRFRLFDMSYRLNNQFYTQYSPNGLPGVEWLNITDRNAVRGF
FT                   SKNTLSGDNGWYLRNTLSHSIPILKGSLDLRAGVDIGRVKGYLSQNGWQSSAGLSTGLT
FT                   WRYQRLLADIEVSRGKLLSHQNRDKDESMQLLTRVSYTF"
     atgattaaaa agacggcaat ttttatctta ttatgtaccg cccttcaggt aaaagcgtca        60
     cctgaagaac tcaatgtcat attaccgaca gatgagacaa gaaggacttt acaagacagt       120
     tcaagggaaa tagaccagtt aattgaacaa cgccgtcacc aaggattagt caatcgttcc       180
     ggtgcccttt cgcctcagac cgtctctcca gtattggtag aagcgccagt atgtctggat       240
     atccgcggcg tctatctcca gggcattacg ctgctgactc tgactgatct gaatacactc       300
     agcacattgc ctgacaactg tattaccagc aatgatatca ataaactgtc agcagaaatt       360
     actaacctct atattgccaa gggctatatt acggcgcggg tgcaatttat tcctcccagc       420
     catcatgggg aattgggaat taatgttgtc gaaggtttta ttgaggccat tgaaggtggt       480
     gatcgctgga tcaatagccg gatgctgttt cctcatctga cgaataagcc actgaatctt       540
     agtcagcttg atcaagggct ggatcaggcg aatcgtctgc aatcaaataa agcaacgctc       600
     gatattctgc ccggtaaggt caatggcggt tcagtcatca ggctgagtaa ccagcattcc       660
     accccgtgga gaatatctac aataaccgat aactacgggc aaaaaagcac aggtaaatgg       720
     ataagccgac tgaatgccag catggacagc ccattggggt tgtccgactt tatcagtctc       780
     agcggcatca gtaccgtcga taaccccgac acccaatata atcgggcggc gactctgttc       840
     tattcacttc catacggtgc tgcgactttc agcggtttta ccagctattc ccgatatatc       900
     agccatccaa agctacagca taatgtgcac aaactgtatg ggaattcaca gcagtcgggt       960
     atgcgtatgg attgggtatt ccaccgcaat caatcacaaa tctcgacatt gaatacccag      1020
     cttgtttaca agaatttcaa caactacttc gatagcgcca aactcagtca cagcagtcaa      1080
     acattaaccg tgttttcact gggcataagc cacttacaaa tcattgcgaa tggccttatc      1140
     acttttgacg caggcattga acagggaaca ccgtggttca gtgcgcaaac ctcaaccgac      1200
     aacttgaata agcaatttac caaaggaaag ttatccgtca atttacagca gcgcttcaga      1260
     ctatttgata tgtcctaccg gctcaataac caattttata cccagtacag cccaaacgga      1320
     ctacccggtg ttgagtggct caatatcacc gaccgcaatg cagtacgagg attcagtaaa      1380
     aatacgttat ccggtgataa cggctggtat ctgagaaata ccttatccca ctcaataccg      1440
     atactcaaag gttcgcttga cctgcgggca ggagtggaca tcggacgggt caaaggttat      1500
     ctcagtcaga atggctggca aagtagtgcc ggattaagta ctggcctgac atggcgctat      1560
     cagcgtctgc ttgccgatat cgaggtcagc cgaggcaaat tattatccca tcaaaataga      1620
     gacaaggatg agtccatgca attgttaaca cgcgtttctt acacctttta a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page