(data stored in ACNUC1104 zone)

EMBL: FN667741.YBGL

FN667741.YBGL        Location/Qualifiers
FT   CDS_pept        532568..533335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0105"
FT                   /gene="ybgL"
FT                   /locus_tag="XBJ1_0530"
FT                   /product="putative lactam utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79674"
FT                   /db_xref="GOA:D3UZ92"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79674.1"
FT                   /translation="MIKAIDLNSDLGESFGQWKMGNDAKMLGIVSSANVACGFHAGDPV
FT                   GILQTLKSAKENQVAIGAHISYPDLVGFGRRNMDIASHELTADVIYQIGALQGLALAAG
FT                   TSVRYVKPHGALYNTIANNERQALAVIEGILVIDPNLALVGLAGSNILRLAQEKGLKTI
FT                   AEAFADRAYTAEGELVSRREAGAVLHDVNLVAQRMLQLVTEGGVDSIDGKFTPIKADSI
FT                   CVHGDSPGALDMAKQVKKVLQQAGITIQSFIHA"
     atgataaaag caattgattt aaatagtgat cttggtgaaa gttttggtca gtggaaaatg        60
     ggtaatgatg caaaaatgtt gggtattgtc agtagtgcaa acgtcgcttg tggttttcat       120
     gctggagatc cggtaggtat tttgcagaca cttaaatctg caaaggaaaa ccaagttgct       180
     atcggagccc atatatctta tcccgattta gtcggttttg gtcggcgtaa tatggatatt       240
     gccagccacg aattgacagc agatgtgatt tatcagattg gtgctctgca aggtttggct       300
     ctagcagcag ggacaagtgt tcgttatgtg aaaccgcatg gtgcgctgta taacacgatc       360
     gctaataatg agcgtcaggc acttgctgtt attgaaggca ttttggtgat tgatcctaac       420
     cttgctttag ttggattggc aggatcaaac attctccgat tggcacagga aaaaggtttg       480
     aaaactatcg ccgaagcttt tgcggatcgt gcttataccg cagaagggga gctagtttcc       540
     cgtcgtgaag ccggtgcggt gttacacgat gtaaatctcg tcgcacaacg catgttgcaa       600
     ttggtgactg aaggtggagt agattccatc gatggcaaat tcacacctat caaggcggat       660
     tccatatgtg tgcatgggga tagtccgggg gctttggata tggcaaaaca ggtaaaaaaa       720
     gttctgcaac aggcagggat taccattcag tcatttatcc acgcataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page