(data stored in ACNUC1104 zone)

EMBL: FN667741.YECC

FN667741.YECC        Location/Qualifiers
FT   CDS_pept        complement(439179..439943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0085"
FT                   /gene="yecC"
FT                   /locus_tag="XBJ1_0431"
FT                   /product="putative amino acid transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79581"
FT                   /db_xref="GOA:D3UZ53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79581.1"
FT                   /translation="MIQLSNIEKSFDGQKVLKNISLTIKEGSLTALIGPSGSGKSTLLR
FT                   CINLLEIPQAGTLEIGKEQITFTGKERLPHREIQRFSLQTGMVFQNFQLFPHLTVIENI
FT                   IEGLIYVQKWPLERARERAQELLKKVGMSHKADVWPNTLSGGQQQRVAIARAMAPSPKV
FT                   LLCDEPTSALDPELSKEVVSVLKHLAEEGTTMVMATHDLRLAANLAHNVIFLESGEIVE
FT                   SGTAQTMFTRPNKQRTGEFISTLTETLPDWEI"
     atgattcagc tctctaacat tgaaaaaagt ttcgacggac aaaaggtgct gaaaaacatt        60
     agcctgacca ttaaagaagg cagcctgaca gcattgatcg ggccttctgg cagtggaaaa       120
     agtaccctgc tacgctgcat caatctgttg gagatcccac aggcgggtac attggaaatt       180
     ggcaaagaac agataacctt caccggcaaa gaacgcctgc cgcacaggga aatccaacgg       240
     ttcagcctgc aaacgggcat ggtattccag aattttcagc ttttccctca ccttacagtg       300
     attgaaaaca tcatagaagg gctgatttat gtacaaaaat ggccactcga acgcgccaga       360
     gagcgggcgc aggaattact gaaaaaagtg ggtatgtccc ataaggcaga tgtctggccg       420
     aacacattat ccggtggtca acaacaacgt gtggctattg ccagagcaat ggctccctct       480
     cccaaagtgc tgctctgtga tgaaccgacc tcagcccttg accctgaatt atcgaaagaa       540
     gtcgtttctg ttctgaaaca cttggcagaa gaaggcacga ccatggtaat ggcgacacac       600
     gatctgcgtc tggccgccaa tcttgcccac aatgttatct ttctggaatc aggcgaaatt       660
     gtcgaatcgg gaacagcaca aaccatgttt acccgcccga ataagcaacg cactggcgag       720
     tttatctcaa ccctgacgga aactttacct gattgggaaa tataa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page