(data stored in ACNUC1104 zone)

EMBL: FN667741.YEIC

FN667741.YEIC        Location/Qualifiers
FT   CDS_pept        434703..435776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeiC"
FT                   /locus_tag="XBJ1_0426"
FT                   /product="putative sugar kinase with ribokinase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79576"
FT                   /db_xref="GOA:D3UZ48"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79576.1"
FT                   /translation="MPSRENQILRLIKQDPFIQQQEIADILGVSRSCVAGHIMNMNKKG
FT                   HIKGKGYIFPSPNNAYAVTIGAANMDFTSYASEKLVYEDSNPGKIISTPGGVGRNIAQN
FT                   IAALKSESHFISVVGNDYNGKVLFEQTKLAGVNIRYFHKLDEEKTSICNSIIDENGKCI
FT                   VSVNDMDIMEKLTPTLLSQSEELIRRASVLVIDCNLTEGALEWLFNHAGNVPIFIDTVS
FT                   TFKATKIRHWLSYIHTLKPNRSEAEILSGIEIETQKDAAIAASWFHQQGVQRLILSMGA
FT                   EGVYYSELDNKSGYSRAITTSVLNASGAGDAMMAGLAHCWLQSMSLEDSIRYAQRCSAL
FT                   TLSSEDTWILPNKSSIP"
     atgccaagca gggaaaacca gatattacga cttatcaagc aagatccttt tattcagcaa        60
     caagaaattg ctgatattct tggggttagt cgttcatgtg tagcaggaca cattatgaat       120
     atgaacaaaa aaggtcatat aaaaggcaaa ggatatattt ttcctagccc taataatgct       180
     tatgctgtca caattggcgc agccaatatg gatttcacca gttatgcctc tgaaaagtta       240
     gtgtatgaag attccaaccc agggaaaata atatcgacgc cgggaggtgt cggaagaaac       300
     attgcacaaa atattgctgc actgaaaagt gaaagccatt tcatttctgt tgttggtaat       360
     gattataatg gcaaggtatt attcgaacaa acgaaactag ctggtgttaa tattagatat       420
     ttccataaat tagatgaaga aaaaacatcg atctgtaatt ccatcattga tgaaaatggc       480
     aaatgcatag tctctgttaa tgacatggac attatggaaa agctcacgcc cacattatta       540
     tctcagtccg aagagttaat ccgacgtgct agtgtattag tcattgactg taatctgaca       600
     gaaggagcat tggaatggct atttaatcat gctggaaatg tgccgatttt tattgatacc       660
     gtttccacat ttaaggcgac taagatccgc cattggctat cttatatcca caccctgaaa       720
     cccaatcgat ctgaagctga aattctcagt ggaatagaaa ttgagaccca aaaagatgcc       780
     gctatcgccg catcctggtt ccatcaacaa ggtgttcaac gtttaatttt aagtatgggt       840
     gcggaaggtg tgtactacag tgaactagat aataaatcag gctattcacg tgcgattacc       900
     accagtgtgc tcaatgccag tggagctggt gatgcgatga tggcaggtct tgcccactgt       960
     tggttacaga gtatgtctct ggaagacagc attcgttacg cacaacgatg ttctgcactc      1020
     acgctgtctt cagaggatac ttggatacta cccaataagt cgtctatacc ttga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page