(data stored in ACNUC1104 zone)

EMBL: FN667741.YHFS

FN667741.YHFS        Location/Qualifiers
FT   CDS_pept        complement(132966..134060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0026"
FT                   /gene="yhfS"
FT                   /locus_tag="XBJ1_0130"
FT                   /product="putative enzyme with PLP-dependent tansferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79281"
FT                   /db_xref="GOA:D3UYA3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79281.1"
FT                   /translation="MKTYPLQSMTMAQAQQQQFKLVDIICRHFPGADFLSQGDLGLVPD
FT                   LHQPRMTHRIEAVIAEHFGAEAAAFVNGAGTGALRAGLAALVSPNATLLVHDAPIYPTT
FT                   KISIEQMGLHVVYADFNHTEQIAAAIRQYQPAASLIQHTRQKIDDSYALQDVLAILHQY
FT                   QIPSLVDDNYAAMKVAHIGCEYGATLSSFSCFKLLGPQGVGLVIGKQTMIETLRRSMYS
FT                   GGCQIQGYQAMEALRGLVSAPVIHAVQAEVNETLVTRLNQGELPQVKQAFLANAQSKVL
FT                   LVEFHDPIAEAVLTAAHGLGALPYPVGAESKFEIPPLFYRISGTFRQADPTLEKRMIRI
FT                   NPNRSGAETVMRILRESIFQKSGQ"
     atgaaaacct atccattgca aagtatgacg atggcgcaag cccagcagca gcagttcaaa        60
     ctggtggata ttatctgtcg tcactttccc ggcgctgatt ttctctcgca aggtgatctg       120
     ggcttagtcc cggatctgca ccaaccccgg atgacccatc gcattgaagc ggtcatcgcg       180
     gagcattttg gtgctgaagc ggcagccttt gtcaatggag ccggaacagg ggcgctacgc       240
     gcggggctgg cggcattagt cagtcccaac gctacattgc tcgtccacga tgcaccgatt       300
     tatcccacga ccaagatatc gattgaacaa atggggcttc acgtggtgta tgcagatttc       360
     aatcatacag aacaaattgc agcggccatc cggcaatatc aacctgctgc cagcctgatc       420
     cagcatacac ggcaaaagat agatgacagc tacgccctgc aagatgtgct cgccatactc       480
     catcagtatc aaattccctc attggtcgat gataactatg cagccatgaa agtggcgcat       540
     attggctgcg aatatggcgc gacactctcc agtttttcct gttttaagtt actggggcca       600
     cagggagttg gcttagttat cggcaaacaa acaatgattg agaccctacg ccgcagcatg       660
     tactccggtg gctgtcagat acaaggctat caggcaatgg aagcattgcg tgggctggtg       720
     tccgcgccag tgatacatgc agtacaggcg gaagttaatg aaacgttggt gacacgattg       780
     aatcaggggg aattgccaca ggtgaaacag gcatttctgg ccaatgctca atccaaagtg       840
     ttattggtgg aatttcacga ccctatcgcc gaagcagtac tgacggccgc acatgggttg       900
     ggagcattac cttatccagt gggtgcagaa tccaagtttg aaatcccgcc gctgttttac       960
     cgcatttccg gtacatttcg tcaggcagat cctacactgg aaaaacgcat gatccgcatt      1020
     aatcccaatc gcagcggggc agaaacagtg atgcgtattt tgcgggaaag tatttttcag      1080
     aaaagcggtc aataa                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page