(data stored in ACNUC1104 zone)

EMBL: FN667741.YHGG

FN667741.YHGG        Location/Qualifiers
FT   CDS_pept        complement(158144..158383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="yhgG"
FT                   /locus_tag="XBJ1_0163"
FT                   /product="putative transcriptional regulator with
FT                   DNA-binding Winged helix domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79314"
FT                   /db_xref="GOA:D3UYD6"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79314.1"
FT                   /translation="MISLLKIRDAVALNGRTDARSLSHQFSTPLPMVEAMLKQLVTMGK
FT                   LEEVDTSSCLSGGCKQCPETQKCTIKVYQLMVKN"
     atgattagcc tgttgaaaat ccgggatgct gtcgccctca acgggcgcac cgatgcaagg        60
     tcactgagcc atcagttttc aacaccgcta ccgatggtag aagccatgct caaacagctc       120
     gtcacaatgg gtaaactgga ggaagtcgat acttcctcct gcctgagcgg tggctgcaag       180
     caatgtccag aaacgcagaa atgcactatt aaggtgtatc aactgatggt aaaaaactga       240
//

If you have problems or comments...

PBIL Back to PBIL home page