(data stored in ACNUC1104 zone)

EMBL: FN667741.YHHQ

FN667741.YHHQ        Location/Qualifiers
FT   CDS_pept        complement(551165..551833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0107"
FT                   /gene="yhhQ"
FT                   /locus_tag="XBJ1_0547"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79691"
FT                   /db_xref="GOA:D3UZA9"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79691.1"
FT                   /translation="MFHLTTQQKATALIWLSLFHILIITSSNYLVQLPVSIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIYGAPLARKIILTVMLPALLISYFISALFFQGTWQGFGTLGTF
FT                   NLFVARIAAASFMGYVLGQILDVGVFNRLRQKRRWWIAPTAAMFFGNLLDTLAFFFIAF
FT                   YRSSDAFMATHWVEIALVDYAFKLFICMLFFLPAYGVLLNLILKFSFSHSTDKTLVKNH
FT                   "
     atgtttcatt tgaccacgca gcagaaagcc acggcgttga tctggctttc gcttttccac        60
     attttgatca ttacttccag taactatctg gtgcaattgc ctgtctccat ttttggtttt       120
     cataccactt ggggagcatt cacatttcct tttatctttt tggcaaccga tctgactgta       180
     cgcatttatg gtgcaccatt ggcacgtaag atcatcctca cggttatgct gccagcgctg       240
     ctgatttcct atttcatttc tgctctattt tttcaaggaa cgtggcaggg attcgggaca       300
     ttaggaacct ttaatctgtt tgttgcccgt attgcagccg cgagctttat gggttatgtc       360
     cttggtcaga tattggatgt gggagttttc aatcgcctgc gtcagaaacg ccgctggtgg       420
     atagcaccga ctgccgccat gttttttggt aatttgctcg atacactggc atttttcttt       480
     atcgcatttt atcgcagcag cgatgcattc atggcgacgc actgggtaga gattgctctg       540
     gtggattacg ctttcaagct gttcatctgt atgcttttct tcctgccagc ttatggtgtc       600
     cttttgaatt taatcctgaa attttctttc tctcattcaa cagataaaac tctggtcaaa       660
     aatcattga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page