(data stored in ACNUC1104 zone)

EMBL: FN667741.YHJJ

FN667741.YHJJ        Location/Qualifiers
FT   CDS_pept        256067..257551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjJ"
FT                   /locus_tag="XBJ1_0252"
FT                   /product="putative peptidase with LuxS/MPP-like
FT                   metallohydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79403"
FT                   /db_xref="GOA:D3UYM5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79403.1"
FT                   /translation="MQGKKIGYLIGGAILATSYLAQAEILQPDPAWQQGKLENGFSWQA
FT                   LQTPQRPNDRIQLRLIVKTGSLAEKTQQHGYTYLIPKVVLFSSKDLSSQKLENLWRNAI
FT                   DSKNPLPPAIVSYDFTLYSLSLPNNRPDLLKDALVWLSDIAGGAVFTPETLAQAMKATD
FT                   HSVATLPADIQDPVWRMRLQGSTLLDHDPGASVSMPVDVKKIEAFYRQWYTPDAMTLYV
FT                   AGHVDSRVLSERINQVFSPLKGKRQTPVAVATLLPLKSETLGVVSDKAQQDRLSLVWNL
FT                   NWQPINDSQTLLQYWLNDLAREALYRYLQLGREEKQADMKLDLDCRILYQRANCFLNMD
FT                   TSSDKLTESTLYLASELASLRENGLPQEQFDELYAQKRLQLQQLFAVYARTNTDLLINQ
FT                   RLISQQNNVVDIAPEQFQRLRQTFLSSLTPPLLNKKLKEMLSQDISFILVQPKDETAVN
FT                   VNQLRNGFNQIMRPGPVPETPAIDTKQDADIKKGAE"
     atgcagggca agaaaatcgg gtatcttatt ggtggcgcca ttctggctac gtcttattta        60
     gcacaggcag agattttgca gcctgatccg gcttggcaac aaggtaaact tgaaaatgga       120
     ttcagttggc aagccctgca aactccacag cgtcccaatg acaggataca actgcgttta       180
     atcgtgaaaa ccggttcact ggcagagaaa acgcaacaac acggctacac ctaccttatt       240
     ccaaaagtcg tattgttcag cagcaaagat ttgtcatcgc aaaaactgga aaatctatgg       300
     cgcaacgcga ttgatagcaa aaatcccctt cctcctgcca ttgtttcata tgatttcacg       360
     ctttatagcc tcagcctgcc aaataaccgc cctgatttac tgaaagatgc actggtatgg       420
     ctgtcggata ttgcgggtgg tgcggttttt acgccagaaa ccttggcaca ggcgatgaaa       480
     gcgaccgatc attccgtcgc gactttaccc gcagatatac aagatcctgt gtggcggatg       540
     cggctgcaag gctcgacatt gctcgatcat gatccgggtg cgagcgtatc aatgcctgta       600
     gatgtcaaaa aaattgaagc attttatcgg caatggtaca cgccagatgc gatgacgctg       660
     tatgttgctg gtcatgttga cagccgggta ctgtcagagc gcattaatca ggtgttttcg       720
     ccattaaaag gaaaacggca gacaccggta gccgttgcga cgttgttgcc gctgaaatca       780
     gaaacgcttg gcgtagtcag tgataaagct caacaagatc ggctgtcttt agtctggaac       840
     ctgaactggc aaccgattaa cgattcgcag accctgcttc agtattggtt aaacgatttg       900
     gctcgtgaag cgctttatcg ctacctgcaa ttggggcggg aagaaaagca ggctgacatg       960
     aagttagatc tggattgtcg catattgtac cagcgggcaa attgcttctt gaatatggat      1020
     acttcttcgg acaagctgac agaatctaca ctttatctgg cttctgagct ggcatcattg      1080
     cgtgagaatg gcctgccaca agagcaattt gatgaactgt atgctcaaaa acggcttcaa      1140
     ctgcaacagc tctttgcggt ctatgcccgc acaaatactg atctattgat taaccagcgc      1200
     ctgatttcac agcagaataa tgtggtcgat attgcaccgg agcaatttca acgcttaagg      1260
     cagacgtttt tatcttctct gacaccaccg cttttgaaca aaaaactgaa agagatgttg      1320
     tctcaggaca tctcctttat tctggtgcag ccaaaagatg aaacggccgt taatgtgaat      1380
     cagctcagaa acggttttaa ccagattatg cggccgggtc ccgtgccgga aacaccagcc      1440
     attgatacca agcaagatgc tgatatcaaa aaaggggcgg agtag                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page