(data stored in ACNUC1104 zone)

EMBL: FN667741.YICE

FN667741.YICE        Location/Qualifiers
FT   CDS_pept        complement(228436..229821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicE"
FT                   /locus_tag="XBJ1_0229"
FT                   /product="putative purine/xanthine transport protein (NCS2
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79380"
FT                   /db_xref="GOA:D3UYK2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79380.1"
FT                   /translation="MVTSSREHSTSEAPEASGSELIYRLEDKPPLLHALFAASQHLLAM
FT                   FVAVITPAMLICQALGLPELDTQRIISMSLFASGVASLIQIRSWGPVGSGLLSIQGTSF
FT                   NFVAPLIMGGLALKNGGADIPTMMAALFGTLMMAAITEVLLSRVLHLARKIITPLVSGI
FT                   VVMIIGLSLIQVGLTSIGGGYSAIQNGTFGVPENLLLAGAVLAVIVLLNRQRNPYLRVA
FT                   SLVIAMAVGYLLAWYMGMLPHATPRTDTPVITVPSPFYYGLSFDWNLLIPLILIFMVTS
FT                   LETIGDITATSDVSEQPISGPLYMKRIKGGVLANGLNSIVSAVFNTFPNSCFGQNNGVI
FT                   QLTGVASRHVGYIIASMLILLGLFPAVAGFVQHIPEPVLGGATIVMFGTIAASGVRIVS
FT                   REPLNRRAIMIIALSLAVGLGVSQQPLILQFAPEWMKNLLSSGIAAGGLTAILLNLIFP
FT                   QEK"
     atggttacct catcccgtga gcactctaca tcagaagcac ctgaggcatc aggcagcgaa        60
     ttgatttacc gtctagaaga taaaccgcca cttctacacg cactgtttgc agccagccaa       120
     catctgctgg cgatgtttgt tgccgttatc acacccgcca tgttgatttg tcaggctctg       180
     gggcttcctg aactggatac acaacgcatt atcagcatgt ctctgttcgc atcaggggta       240
     gcatcgctta tccagatccg ctcctggggg cctgtcggct ctggcttgct ttccattcag       300
     ggaaccagtt ttaattttgt tgcgccacta atcatgggag gactggctct taaaaatgga       360
     ggagcagata tcccaaccat gatggccgct ctgtttggta cgctgatgat ggcggcaatc       420
     accgaagtgc tgctgtcccg cgtgttgcat ctggccagaa aaatcattac gccgctggtt       480
     tccggtattg tcgtgatgat tatcggtctg tcgctaatcc aagtcgggtt gacttccatc       540
     ggcggcggtt actctgccat tcaaaatggt acgtttggtg tgcctgaaaa tctgctgctg       600
     gcaggagccg ttcttgccgt tatcgtgcta ctgaatcgcc agcgtaatcc ctacctgcga       660
     gtggcttctc tggtcattgc tatggcggta ggctatctgt tggcttggta catgggtatg       720
     ctacctcatg cgacacccag aacagacaca cccgttatca ccgttccctc tccgttctat       780
     tacggactgt cttttgactg gaatctactg atccccctta tcctgatttt tatggtgacg       840
     tcgttagaaa ccatcggcga tattacagcg acatccgatg tttcagagca gccaatcagt       900
     ggcccgttat atatgaaacg cattaaggga ggtgtactgg caaatggtct taattcgata       960
     gtttccgcag tattcaatac atttccgaat tcctgttttg gccagaacaa tggtgtgata      1020
     caactgaccg gcgttgccag ccgccatgtt ggttacatta tcgcgtctat gctgatcctg      1080
     ttggggctgt tccccgccgt ggccggattt gtacaacata ttcctgaacc cgtgttaggg      1140
     ggcgccacta ttgtcatgtt cgggactatc gccgcatccg gtgtcagaat tgtttcccgc      1200
     gagccactga accgtcgcgc cattatgatc atcgcgttgt cgctggccgt tggtttaggc      1260
     gtatcccaac aacccttgat tttacagttt gcacctgagt ggatgaaaaa tctgctatct      1320
     tccggcattg ccgctggtgg gctgactgca attcttctga acctgatttt tccgcaggaa      1380
     aaatag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page