(data stored in ACNUC1104 zone)

EMBL: FN667741.YICG

FN667741.YICG        Location/Qualifiers
FT   CDS_pept        complement(238882..239499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yicG"
FT                   /locus_tag="XBJ1_0237"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79388"
FT                   /db_xref="GOA:D3UYL0"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79388.1"
FT                   /translation="MLLSVLYIIGITAEAMTGALAAGRRKMDVFGVIIIASVTAIGGGS
FT                   VRDIILGHYPLGWVENPAYIVTVACAAVITIWVAPMMKHLRRLFLILDAIGLIVFSIIG
FT                   AQIALDMNHSPIIAAIAAVITGVFGGVLRDMFCNTIPLVFQKEIYAGVSFAAAWLYIGL
FT                   LHTPLHPNSVVLITLTAGLAARLIAIRYRLGLPIFNYEGSEH"
     atgctactta gtgttcttta tatcattggt atcacggctg aagccatgac aggcgcctta        60
     gccgcaggtc gccggaaaat ggatgtgttc ggcgttatca ttattgcttc cgtgacggcc       120
     attggtggtg gctccgtccg tgacattatt ctgggtcatt acccacttgg ctgggtagaa       180
     aatccagcct acatcgtgac tgttgcctgc gctgcggtga tcactatctg ggttgccccc       240
     atgatgaaac atctgcgccg tttatttctc attctcgatg ccattggtct gattgtcttt       300
     tccattattg gtgcacaaat tgctctggat atgaaccaca gcccgatcat cgccgccatt       360
     gctgccgtga ttacgggggt ttttggcggg gtactgcgcg atatgttttg taatactatc       420
     ccgctggtat tccagaaaga gatctatgcg ggtgtttctt tcgctgccgc ttggctatat       480
     atcgggttat tacacacgcc attgcacccg aacagcgtgg ttctgattac gcttaccgca       540
     gggctggcgg ctcgattgat tgctatccgt tatcgtcttg gtttacccat cttcaattat       600
     gagggttctg agcactga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page