(data stored in ACNUC1104 zone)

EMBL: FN667741.YJGP

FN667741.YJGP        Location/Qualifiers
FT   CDS_pept        451085..452185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0089"
FT                   /gene="yjgP"
FT                   /locus_tag="XBJ1_0448"
FT                   /product="putative transmembrane protein, transport"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79598"
FT                   /db_xref="GOA:D3UW89"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79598.1"
FT                   /translation="MIIIRYLVRETLKSQIAILFILLLIFFSQKLVEVLGAAVEGSVPA
FT                   NLVLSLLGLGVPEMAQLILPLSLFLGVLMTFSKLYTESEITVMHACGLGKGVLVKSALI
FT                   LALFTSMLAAANVLWFTPWSSKYQEQVLADAKANPSLAAIMEGQFKPSRDGNMVLYIGD
FT                   VKGNNFENVFLAQLRPVNNQRPSVVIADGGHMEERPNGNQVAVLHQGVRYEGTALMRDF
FT                   RITDFKNYQAVIGHKAADIDSDKVEQKTFSQLWHKGDEDSRAELHWRLTLIVSVLVMAL
FT                   LVVPLSAVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSNGGRGKLDPAFWMWLVNGAYFA
FT                   LALALNMWDTVPMRKLRSRFKNQGAA"
     gtgatcatca ttagatatct agtacgggaa actctgaaaa gccaaatcgc aatacttttc        60
     atcttattgc tgatcttctt cagccaaaaa ttagttgaag tattgggtgc ggcggttgaa       120
     ggaagtgttc ccgcaaattt ggttctatcc ttgttaggtt taggtgtgcc ggaaatggcg       180
     cagcttattt tacccctgag tctgtttctt ggggtattaa tgacgttcag caaactctat       240
     accgaaagtg agattaccgt catgcatgcc tgtgggttgg gcaaaggtgt gttggtaaaa       300
     tcggccttga ttctggcctt gttcacatca atgctggcgg cggctaacgt tctctggttc       360
     actccgtggt cttctaaata ccaagagcaa gtgttggcgg atgcaaaagc taacccaagt       420
     cttgcggcca ttatggaagg tcagtttaag ccttcccgtg atggcaacat ggtgctgtat       480
     atcggtgacg tcaagggcaa taactttgag aatgtgttcc ttgctcagct ccgaccggtg       540
     aataatcagc gcccttccgt ggtgattgcg gatggcggcc atatggaaga gcgtccgaat       600
     ggtaatcagg tcgcggtact ccatcagggg gtgcgttatg aaggcactgc actgatgcgt       660
     gacttccgca ttaccgattt caaaaattat caggcggtga ttgggcacaa agccgctgat       720
     attgatagcg ataaagttga gcagaagaca ttctcccagc tctggcacaa gggtgacgaa       780
     gattcccgtg cagagctgca ctggcgcctg accctgattg tgtcggtgct ggtcatggcg       840
     ctgctggtgg ttccattgag tgccgtgaac ccgcggcagg ggcgtgtgct cagtatgctg       900
     cctgctatgc tgctttacct gattttcttc ctgctgcaaa gttccctgcg ctccaatggc       960
     ggcaggggta aactcgaccc cgcattctgg atgtggttgg tcaacggagc ctattttgcc      1020
     ttggcgctgg cgctcaatat gtgggatacc gtacccatgc gcaaactgcg ttctcgcttt      1080
     aagaatcaag gagcggcctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page