(data stored in ACNUC1104 zone)

EMBL: FN667741.YRFF

FN667741.YRFF        Location/Qualifiers
FT   CDS_pept        75246..77303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="yrfF"
FT                   /locus_tag="XBJ1_0068"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79219"
FT                   /db_xref="GOA:D3UY41"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79219.1"
FT                   /translation="MVSFLTFRWKRPDNARYLPSIAKTGHRKLNADEYQAIDSYLQNAL
FT                   SLMQPDRSHRSGQPALSVKNDTVYTINHTINRFSVATDESQYWRYYVDEMEIHLPALLE
FT                   SFIKQQNTIEIVQTTFMPLVIAVNGHFLKDYQQDLSIARIVKQTAQASIQKNGNSIANF
FT                   LYIRKETPEENRLRRSTGILEGILMCIGLSLWFLALFMPTPILPWLMLAAVLFLITSFW
FT                   LTFRSPSPRNILNISCFNGIPKRWGIFSESEPEQRRNISLGGIDLIYPSHWEPYVVREL
FT                   DQNTDVDIYTNCHVVQQGRYLSLHEEEKHYPYQRYRKNLILVVFSICAMLVLYFYQPVS
FT                   LSMRLSFAWLYGSNTQVITSVTELQNMPLKEGDVLRVKGIGMCYIPPRLNDNPGGIKHI
FT                   FTAFDCTGIYWNNDSPLPIPESDIIENASTLITTVNEQLHPIERSRKTNSDLNEAIAKS
FT                   GMTLLDNFSQVILKTHNLCMDEIDCIRLKSALVNLSNAEDWNDLLKQAERGKLNGTKVL
FT                   LRSVSADALEKLIDTTTASFIYREIDKISILLNSPSPGGVLLISEEGNKLVELPYLPFL
FT                   TYEYSALDQWRELQRLAEILLSAPFEAVGIVTKLSEDANETRRITLHSEPDSVTLIRYL
FT                   GSCFFLAILMAILSINAILIISKRQKNKVRLQRIGEYYDNCFNSKQPPMD"
     atggtttcct ttctgacttt cagatggaag cggcctgata acgcgcgtta tctaccgtca        60
     atcgccaaaa caggccatcg taagctgaat gctgatgaat atcaggcaat tgattcttat       120
     ttgcaaaatg ctctgtccct gatgcagcca gataggagcc acagatcagg ccaaccagca       180
     ctgtctgtca aaaatgatac ggtttatacc atcaatcaca ccatcaaccg cttttctgtc       240
     gctacggatg aatcgcagta ttggcgctat tatgttgatg aaatggagat acatcttcct       300
     gcgttacttg agtcattcat taagcagcag aatacgattg agattgttca aaccacattc       360
     atgcctcttg ttattgccgt gaatggccac ttcctgaaag attatcagca agatctgtcc       420
     atcgcgcgaa tcgtgaaaca aacggcacag gcttcaatcc aaaaaaacgg caattccatt       480
     gccaattttt tgtatatccg caaggaaacg ccggaagaga atcgtctgcg tcgttcaaca       540
     ggcattctgg aaggcattct catgtgtatt ggcttgtcgc tctggttttt ggctcttttc       600
     atgccaacgc ccatattacc gtggctaatg ttggccgctg ttctgtttct gattaccagc       660
     ttctggctga ctttccggtc accttctccg cgtaacattt tgaatattag ctgctttaat       720
     ggtattccga aacgttgggg tatattcagt gaatctgaac cggaacagcg gaggaatatc       780
     tctctggggg gtattgatct tatctatccc tcacattggg agccgtacgt cgttcgtgag       840
     cttgaccaaa atactgatgt tgatatatat accaattgcc atgtcgttca gcaggggcgc       900
     tacctctcat tgcatgagga agaaaaacac tatccttatc agcgctatag aaaaaacctg       960
     atactggtgg ttttttccat ttgtgctatg ttggtacttt atttttacca gcccgtgagc      1020
     ttatctatgc ggctcagttt tgcatggctg tatgggagta atactcaggt catcaccagc      1080
     gtcactgaac tgcaaaatat gcctctgaag gaaggcgatg tactgcgagt taaaggcata      1140
     gggatgtgct acataccacc cagactgaat gataatcccg gtggaatcaa acatatattt      1200
     actgcgtttg actgcactgg catctactgg aataacgata gcccattgcc cattccggaa      1260
     tcagatatta tcgaaaatgc atcaacattg attacaacgg tcaatgagca attacacccg      1320
     attgaacgta gccggaaaac caactctgac ctgaatgaag ccattgcgaa atcgggtatg      1380
     acattactcg acaatttttc gcaagtcatc ttgaagacgc ataatttgtg catggacgag      1440
     attgactgta ttcgtctgaa aagcgcactg gtcaatctga gcaatgctga ggattggaat      1500
     gatctattga aacaggctga aagagggaaa ctgaatggaa ccaaagtatt attacgttca      1560
     gtaagcgcag atgcactgga aaagttaatt gataccacca cagcatcatt tatttatcgg      1620
     gaaattgata aaataagcat actgctgaac agcccatcgc cggggggcgt cctgctgatc      1680
     agcgaggaag ggaataaatt ggttgaattg ccttatttac catttcttac ctatgaatac      1740
     agcgcactgg atcagtggag ggaattacag cggttagctg aaatactgtt gagtgctcca      1800
     tttgaagctg tcggaattgt gacgaaattg tccgaagacg caaatgagac tcgccgtatc      1860
     accttgcata gtgaacccga ctccgtgact cttattcgtt atctgggaag ctgcttcttt      1920
     ctggcaatac tcatggcgat attgagcatc aatgccattc tgataataag caaaaggcag      1980
     aaaaataagg tgcggctcca gcgtataggc gagtactacg acaattgttt caactcgaaa      2040
     cagccgccga tggattag                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page