(data stored in ACNUC1104 zone)

EMBL: FN667741.YTFL

FN667741.YTFL        Location/Qualifiers
FT   CDS_pept        complement(345549..346775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytfL"
FT                   /locus_tag="XBJ1_0338"
FT                   /product="putative hemolysin-related membrane protein with
FT                   CBS regulatory domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79488"
FT                   /db_xref="GOA:D3UYW0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79488.1"
FT                   /translation="MADEGNLNAAHVLKLQETPGMFFTIVQIGLNAVAILAGVVGESAF
FT                   SPALKTLFSNFMRQEWADQLGFICSFIIVTSFFILLADLIPKRIGMIKPEAVAVRIVNP
FT                   MRFCLATFRPLVWLFNGLADCFFKIFKIPMARNEDITSDDIYAVVAAGALAGVLRKQEH
FT                   ELIENVFELESRTVPSAMTSRESVIYFDKNEDENSIKEKISTHPHSKFLVCDGGIDHVT
FT                   GYVDSKDLLNRVLNGQSLSLKDGVQTRNALMIPDTLSLSDTLESFKAAGEDFAIILNEY
FT                   ALVMGVITLNDVMTTLMGDLVDQGQEEQIVVRDENSWLVEGGTPIEDVLRVLDIDDFPD
FT                   SNNYETIAGFMMFRLRKIPKRTDFVKFSGYKFEVVDIDNYKIDQLLVTKIVDTPAQSNP
FT                   SPSSQAQVQ"
     atggccgatg aagggaacct caatgctgcc catgtgctta agttacaaga aacgccaggc        60
     atgttcttta ctattgttca aattggtctg aatgcagttg cgatcctcgc gggcgtcgtg       120
     ggagaatctg cattttcacc cgccctgaaa acactattct cgaacttcat gcgtcaggaa       180
     tgggccgatc aacttggctt tatctgttct ttcattatcg tcaccagttt ctttattctg       240
     cttgctgatt tgattcctaa acgtattggc atgattaagc ccgaagccgt tgcagtgaga       300
     attgtcaatc caatgcgttt ctgtctggca acttttcgcc cgctggtatg gctgttcaat       360
     ggccttgctg actgtttctt caaaatattt aaaattccta tggcacgtaa tgaagatatc       420
     acttccgatg atatttatgc cgttgttgca gccggagcgt tagcgggtgt attacgtaaa       480
     caggagcatg agctgattga aaatgttttc gaactggaat cccgtaccgt gccttctgcc       540
     atgacttccc gtgaaagcgt tatttatttt gacaagaatg aagacgaaaa cagtatcaag       600
     gaaaaaatat ccacccatcc gcattcaaaa tttctcgttt gtgatggcgg tattgaccat       660
     gttactggct atgtggattc caaagactta ctcaaccgtg ttctgaacgg gcagagcctc       720
     agcttgaaag atggtgttca aacccgcaat gccttgatga ttcctgatac gctctcactc       780
     tctgatacgc tagaaagttt caaagcggct ggtgaagatt ttgcgatcat cctcaacgag       840
     tatgcattgg tgatgggagt cattactttg aatgacgtaa tgaccacctt aatgggcgat       900
     ttagttgatc aggggcagga agagcagatt gttgtccgcg atgaaaattc atggcttgtt       960
     gaaggtggca caccaataga agatgtgttg cgagtactgg atatcgatga tttcccagac      1020
     tccaacaatt atgaaaccat cgcaggattt atgatgtttc gcctgcggaa aattccaaag      1080
     cgtacggatt ttgtgaaatt cagcggctac aaatttgaag tggtggatat tgataattac      1140
     aaaatcgacc aattgctggt gacgaaaatt gtggacacgc ctgcccaatc caacccatct      1200
     cccagcagtc aagcacaggt ccagtaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page