(data stored in ACNUC1104 zone)

EMBL: FN667741.YTFM

FN667741.YTFM        Location/Qualifiers
FT   CDS_pept        347820..349562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0069"
FT                   /gene="ytfM"
FT                   /locus_tag="XBJ1_0341"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79491"
FT                   /db_xref="GOA:D3UYW3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79491.1"
FT                   /translation="MSRYPFIFVLCVSVATPSAYSANLRLKVEGLSGELEKNARVQLSN
FT                   ISTEEVAPDARFQARVEKAIQQGLRPLGYYDPTVEFTYQEKTPPSRPVLTANVTPGEPV
FT                   RVVEVNVDLEGSAKTDKDYAALIKKNMPKEGAILNHGEYEHFKGALNSLAVRKGYFDAV
FT                   MKKSELEVSQEQHKSYWNFDFDSGDRYRFGSVRYHGSQIRENYLNNLLPFKQGEYYTSD
FT                   QLAEFNSRLANTGWFNSVVVVPDFKVGHTSQDKLLPLDAFLVPSSANYVELGGGYATDV
FT                   GPRVKAKWKKPWLNSRGHSLSTNINLSAPEQVIDASYKMPLKSNPLEQYYELQTGYKRK
FT                   DINDTISDTATLNLSRNWDLFTGWQYGVNLRWSLSHFTQANVTNTTMLLYPGATVSRIR
FT                   QRGGTMPYWGDSQRYSIDFSDKTWDSNVDFLVLQAHHVWIRTYKDKHRFVVRGDLGWIE
FT                   TNEFNKVPPGLRFFAGGDRSIRGYKYQKISPKNSEGKLTGASKLAVGSLEYQYNIYGNW
FT                   WSALFVDTGEAVDDIKKSDFKTGAGIGVRWASPVGPIKFDLATPVGDASNHGIEFYIGL
FT                   GAEL"
     gtgtcacgat accccttcat atttgtgctt tgcgtgtctg tcgcaactcc atcggcctat        60
     agtgcaaatt tacgattgaa agtggaaggt ctttctggcg aactggaaaa aaatgccaga       120
     gtacagctct caaacataag taccgaggaa gtcgctcccg atgcgcgctt tcaggcccgt       180
     gtcgagaaag ccatacagca agggttaagg ccattgggat actacgatcc cactgttgaa       240
     ttcacttatc aggagaaaac accaccttcc cgccctgttt tgacagcgaa cgtgacaccg       300
     ggtgaaccgg tacgggtagt cgaagtcaat gttgatttgg aaggtagcgc aaaaactgat       360
     aaagattatg cagcactcat caaaaaaaat atgccaaagg aaggggcgat cctgaatcat       420
     ggtgaatacg aacatttcaa gggtgcattg aatagtctgg cagttagaaa gggttatttt       480
     gatgctgtga tgaaaaaaag tgaattagaa gtatcacagg agcagcataa atcctattgg       540
     aacttcgatt tcgacagcgg agatcgttac cgctttggct ccgtgagata ccacggctcg       600
     caaattcgtg aaaattacct gaacaatctt ttgccgttta aacaaggtga gtattacact       660
     tcggatcaac ttgcggaatt caacagtcgt ctggcgaata ccggatggtt caattctgtg       720
     gtggtcgtgc ctgattttaa ggtaggccac acgagccagg ataagttatt gccactggat       780
     gctttcttgg ttcccagctc tgccaattat gttgaactag ggggaggtta tgcaacggat       840
     gttggccccc gcgttaaagc aaaatggaaa aagccatggc ttaactctcg tgggcatagc       900
     ctgagtacca atattaacct gtcggcacct gaacaagtta ttgatgcatc ctacaaaatg       960
     ccactcaaat ctaatccgct tgaacaatat tatgagttgc agacaggtta taaacgtaaa      1020
     gatattaacg ataccatttc tgatacggca acattgaacc tttcccgcaa ttgggatctc      1080
     ttcaccggat ggcaatatgg tgtcaactta cgctggagtc ttagtcactt tacgcaggct      1140
     aacgtgacaa atacgacgat gctactctat ccgggagcga ctgtcagccg aattcgccag      1200
     cgtggtggca ctatgcctta ttggggagat agtcagcgtt attcaataga tttttccgac      1260
     aaaacctggg attcgaatgt ggatttcttg gtgttacagg cccatcacgt ctggatcagg      1320
     acttataagg ataagcaccg ctttgtggta cggggtgatc taggctggat tgaaaccaat      1380
     gaattcaaca aagttccacc gggtttacgt ttcttcgccg ggggggatcg cagcatccgt      1440
     ggttataaat accaaaaaat ttcaccgaaa aatagtgagg gaaaactgac tggggcatcg      1500
     aaactagccg ttggctcact ggaatatcaa tacaatatct atggaaactg gtggagtgcg      1560
     ttgtttgtgg atactggcga agcggtggat gatattaaaa agagtgattt taaaaccggc      1620
     gcagggattg gtgtgcgttg ggcctcaccc gttgggccaa ttaaatttga tcttgcgacg      1680
     ccagtaggag acgcaagcaa tcatggtatt gagttttaca tcggtttagg ggctgaacta      1740
     tga                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page