(data stored in ACNUC1104 zone)

EMBL: FN667742.ACCA

FN667742.ACCA        Location/Qualifiers
FT   CDS_pept        545264..547027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0118"
FT                   /gene="accA"
FT                   /locus_tag="XNC1_0633"
FT                   /product="bifunctional protein [Includes: biotin
FT                   carboxylase; biotin carboxyl carrier protein]"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88704"
FT                   /db_xref="GOA:D3VJE8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88704.1"
FT                   /translation="MNTLYNKSKKVLIANRGEIAVRIIRACRDYGIQTIAVYADVDVNA
FT                   LPVQLADEAYRLGGNTPAETYLHIPRLLEIAQQSGATMVHPGYGFLSERAEFARAVIDA
FT                   GLIWIGPHPETIDELGDKIKARRIAQKVGAPLVIGTAEPVKDVQEVVAFAETHGLPIAI
FT                   KAAFGGGGRGLKVAWRLDEVAELYHSAVREATAAFGRGECFIEQFLNNPRHIEAQVIAD
FT                   KQGNVVVLGTRDCSLQRRNQKLVEEAPAPFLTQEQRERIHQSAKAICVEANYVGAGTVE
FT                   FLLSADGALSFLEVNTRLQVEHPVTEETTGIDLVIEQLRVAEGYPLSIQETPVPKGHSF
FT                   EFRINAEDAGKGFLPTSGIISEFIAPSGPGIRLDSGVLSGSIIPATFDSLMAKLIVTGA
FT                   NREQAISRARRALREFEISGVASVLPFHQAVMEHPDFVSSDNFHVHTRWIETDFVNALE
FT                   RSPRQAVKEDKGITRTFIEIDGCRHELGLPSDLLSGLTQLVPVSERPFFKPLAKEKVAE
FT                   DPHQVKAPISGVLHSWLVTEGEEVRDGDVIAVMEAMKMEVQISAHRSGKITFCVRAGDY
FT                   HDAESILATID"
     atgaacacac tatataataa atctaagaaa gtgttgattg ccaaccgtgg tgaaattgcc        60
     gttcggatta ttcgcgcttg ccgtgattat ggcatacaga caatcgctgt gtatgcggat       120
     gttgacgtta acgcactacc tgtgcaattg gctgatgaag cttatcgttt aggtggaaat       180
     acgcctgcgg aaacttacct tcatattcca cgtttactgg agatagcgca gcagtcggga       240
     gcgacaatgg tgcatccggg atacggtttc ctgtctgaaa gggcggaatt tgcccgtgca       300
     gtgattgatg cgggattaat ttggattggc ccgcatcctg aaactattga tgaactgggt       360
     gacaagatta aggcgcgtag aattgctcag aaagtgggag cacccttggt cattggcaca       420
     gcagagcccg tgaaggatgt acaagaagtt gttgcttttg cggaaacaca cggtttgcca       480
     atcgcgatta aagcggcatt tggtggtggg ggccggggtt tgaaagtcgc ttggcgtctg       540
     gatgaagtgg cagaacttta tcattcggct gtacgtgagg cgacggctgc atttggtcgt       600
     ggagaatgct ttattgagca attcttgaat aatcctcgcc atattgaagc gcaggtgatt       660
     gcggataaac agggtaatgt tgtcgtactc ggaacgcgtg attgctcctt gcaacgccgg       720
     aatcagaaac tggtagaaga agcgccagca cccttcttaa cacaggaaca aagagaacga       780
     attcatcaat cagcaaaagc tatttgtgtg gaagccaatt atgtgggagc tggcactgta       840
     gagtttttac tcagcgcaga tggagcactg tctttccttg aagtcaatac tcgcttacaa       900
     gttgagcatc cggtgacaga agaaacaaca ggtattgatc tggttattga acaattgcga       960
     gtggcggaag gttatccgct gagtatacag gaaacgcctg taccaaaagg ccactcattt      1020
     gagtttcgca ttaatgcaga agatgctggc aaaggtttct tgccgacatc cggaatcatc      1080
     agcgaattta tcgcgccttc tggccccgga attcgcttgg attctggggt actaagtggc      1140
     tccattattc ccgcaacttt tgattcattg atggcgaaat taatcgtcac aggggcgaat      1200
     cgtgaacagg caatttcccg tgcccgtcgt gcattacggg aatttgaaat cagtggcgtg      1260
     gcatcggtat tgccttttca tcaagccgtg atggaacatc ccgattttgt ttccagtgat      1320
     aacttccatg tccatacccg ctggatagaa acggattttg tcaatgcact ggaacgttca      1380
     cctcgtcagg cggtaaaaga ggataaaggc attactcgta catttattga aattgatggt      1440
     tgcagacatg aactggggtt accgtcggat ttattgtcgg ggttaacaca attggtgccc      1500
     gtaagtgaac gtccattctt taagccgctt gcaaaagaaa aagtggcgga agatcctcat      1560
     caagtgaaag cgcctatttc cggagtcttg cactcatggt tggtgacaga aggtgaggaa      1620
     gtcagagatg gtgatgtgat tgccgtgatg gaagcaatga agatggaagt gcaaatcagc      1680
     gcccatcgtt cgggaaaaat cacattctgc gtacgagcag gtgattatca tgatgcagaa      1740
     agcatactgg ctactattga ctag                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page