(data stored in ACNUC1104 zone)

EMBL: FN667742.ARGB

FN667742.ARGB        Location/Qualifiers
FT   CDS_pept        234777..235550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0055"
FT                   /gene="argB"
FT                   /locus_tag="XNC1_0269"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88357"
FT                   /db_xref="GOA:D3VH72"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88357.1"
FT                   /translation="MVPLVIKLGGVLLDSEEALERLFTTLQLYRKTHKRPLVIVHGGGC
FT                   LVDEMMQKLQLPILKKQGLRVTPEDQIDIITGTLAGTANKKLLAWAIKLRLPAIGLCLG
FT                   DGGMVKVSQLDKTFGHTGMAIAGEPDLLKILLDVGYMPIISSIGITEHGELMNVNADQA
FT                   ATAIAQVLNADLVLLSDVSGILDGKGQKIPEATAEKIEQLIEQGIITDGMIVKVNAALD
FT                   AAKTLGQPVDIASWRHSEQLIALFNGIPVGTRILA"
     atggttccgt tagttatcaa gttgggtggt gtattattgg acagtgaaga agcactggaa        60
     cggttattta ccacattgca gctgtaccgt aaaactcaca aacgtccact ggttattgta       120
     catggtgggg gttgtttggt tgatgagatg atgcagaaat tgcagttacc cattttgaag       180
     aaacagggat tgcgggtcac gcctgaagat caaatcgaca ttattacagg cacattagca       240
     ggaacagcta acaagaaact gctggcatgg gcaattaaac tccgtttacc cgccattggg       300
     ctatgtctgg gggatggggg aatggtgaag gtttcccagc ttgataaaac ctttggtcac       360
     acaggaatgg cgatagcggg ggaacccgat ctcctgaaaa ttttgttgga tgtcggctat       420
     atgccgatca tcagttcaat tggtatcact gaacacggtg agctgatgaa tgtgaatgcg       480
     gatcaggcgg caactgccat cgctcaggtg ctgaatgcgg atttggtttt gctgtctgat       540
     gtcagcggta ttctggatgg taaagggcaa aagatcccgg aggcgacagc agaaaagatc       600
     gaacagttaa ttgaacaggg cattattacg gacggcatga tagtgaaagt caatgcagca       660
     ttggatgcag caaaaacgct cggacaaccc gtggacatag cgagttggcg gcattcagaa       720
     caattgattg cgttatttaa tggcataccg gttggcacac gaattttggc gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page