(data stored in ACNUC1104 zone)

EMBL: FN667742.AROE

FN667742.AROE        Location/Qualifiers
FT   CDS_pept        288204..289022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0067"
FT                   /gene="aroE"
FT                   /locus_tag="XNC1_0354"
FT                   /product="dehydroshikimate reductase, NAD(P)-binding"
FT                   /function="16.15 : Symbiosis"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 16164547; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88436"
FT                   /db_xref="GOA:D3VHU7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88436.1"
FT                   /translation="MDKFVVFGNPVAHSKSPYIHQLFSEQTGIDHQYGRILAPIEQFEQ
FT                   VLDYFFEQGGLGANITVPFKEKAYQLSDKLTERAKISGAVNTLKRIEGNRLLGDNTDGI
FT                   GLVVDLQRLNFISQGKNVLIIGAGGAAKGVISPLFSLGCSITITNRTFERAQIIANKFS
FT                   QLGNIRAIEIESLHSKDFDIIINATASGLDGQIPSVSPLIFQSNCACYDMYYQQGLTPF
FT                   LNFAHQNGVSHLADGLGMLVGQAAYAFELWHGVFPEIEPVLVALRRELHS"
     atggataaat tcgtggtttt tggtaatcca gtagcacaca gtaaatctcc ttatattcat        60
     caattgtttt ctgaacaaac aggaatagat catcaatatg ggcggatact tgctccgata       120
     gagcaatttg aacaagtgtt agactatttt tttgaacaag ggggattagg cgcgaatatt       180
     actgtccctt tcaaagaaaa agcttatcag ctctctgata aattaactga gcgggcaaag       240
     ataagtggtg cagttaacac attaaaacgg atcgagggaa atcggctgct tggtgataat       300
     acagatggta taggtcttgt ggtggattta cagaggctca atttcatctc ccaagggaaa       360
     aatgttttaa taattggtgc tggtggagcg gcaaaaggag taatatctcc tttattttca       420
     ttaggctgtt caatcactat tactaaccgt acgtttgagc gtgctcaaat cattgcgaat       480
     aaattttctc aattgggtaa tatccgagct attgaaatcg aatctcttca ttccaaagat       540
     tttgacatca tcattaatgc aacagcttct ggacttgatg ggcagatacc ctcggtatct       600
     ccgcttattt tccaaagcaa ttgtgcttgt tatgacatgt attatcagca aggactcacc       660
     cctttcctta attttgctca tcaaaatgga gtttcacatt tagctgatgg tttaggcatg       720
     ttagtcgggc aggctgcata tgcttttgaa ttgtggcatg gagtgtttcc agaaatagaa       780
     cctgttttag ttgcgttaag gcgggaatta cattcatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page