(data stored in ACNUC1104 zone)

EMBL: FN667742.AROK

FN667742.AROK        Location/Qualifiers
FT   CDS_pept        complement(65315..65836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0011"
FT                   /gene="aroK"
FT                   /locus_tag="XNC1_0062"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88150"
FT                   /db_xref="GOA:D3VG60"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88150.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKIINELTEKQGIVLATGGGSVKSKETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDTPAREVLENLADERNPLYEEIADVTIRTDEQSAKVVA
FT                   NQIIELLEKN"
     atggcagaga aacgcaatat ctttctggtt gggcctatgg gtgccggcaa aagcactatt        60
     ggtcgtcagt tagctcagca actcaatatg gagttttacg actctgatca agaaattgag       120
     cgacgtaccg gagctgacgt gggctgggta tttgatgtgg aaggcgaaga aggcttccgc       180
     gaccgcgaag aaaaaataat taacgaactg actgaaaaac aaggcattgt attggctacc       240
     ggagggggtt cagttaaatc gaaagaaacc cgcaatcgcc tgtctgcccg tggtgtggtc       300
     gtctatttag aaacaaccat cgaaaaacag ttagctcgta cccagcgcga caaaaaacgc       360
     cctttacttc aagttgatac accagcacgt gaagttttag aaaatttggc tgatgagcgt       420
     aatcctcttt acgaggaaat tgctgacgtg actattcgta cggatgagca aagcgccaaa       480
     gtcgtcgcta accaaatcat tgaattattg gaaaagaact ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page