(data stored in ACNUC1104 zone)

EMBL: FN667742.ASNA

FN667742.ASNA        Location/Qualifiers
FT   CDS_pept        39827..40819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnA"
FT                   /locus_tag="XNC1_0037"
FT                   /product="asparagine synthetase A"
FT                   /EC_number="6.3.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1369484, 6117826, 9437423; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88130"
FT                   /db_xref="GOA:D3VG40"
FT                   /db_xref="InterPro:IPR004618"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88130.1"
FT                   /translation="MKTSFIEKQQQISFVKSYFSRLLEKQLGLIEVQGPILSRLGDGTQ
FT                   DNLSGHEKAVQVKVKTLPDATFEVVHSLAKWKRKTLGRFGFQAEQGLYTHMKALRPDED
FT                   RLTPIHSVFVDQWDWEKTMGEGQRSLDYLKQTVGKIYEAIKETQQAVSKEFGLAPFLPD
FT                   QIHFIHSEELLKRYPDLDAKGREREAAKEFGAIFLMGIGGKLSDDQSHDVRAPDYDDWT
FT                   SPNSDGFFGLNGDIIVWNPVLQDAFEISSMGIRVDAEALQRQLELTGDEDRLQYDWHQA
FT                   LVKGDMPQSIGGGIGQSRLVMLMLQMPHIGQVQCGVWSPEIIESVEGVL"
     atgaaaacat ccttcattga aaaacagcag cagattagtt ttgtgaaatc atacttttct        60
     cgcttgttag agaaacaact cggtttaatt gaagttcaag ggcctatctt gagccgcctt       120
     ggtgatggta cgcaggacaa cctttctggc catgaaaaag ctgtacaggt aaaagtaaaa       180
     acattacccg atgcaacatt tgaagtggtt cattctctgg cgaaatggaa gcgcaagaca       240
     ttaggtcgtt ttggcttcca ggctgaacaa gggttatata cccatatgaa ggctctgcgt       300
     cctgatgaag atcgcttgac cccaatccat tctgtgtttg tggatcagtg ggattgggag       360
     aagacgatgg gtgaaggtca acgttcactc gattatttaa aacagacagt aggtaaaatc       420
     tacgaagcaa taaaagaaac acaacaagcg gtaagtaagg aatttggtct ggcaccgttc       480
     ctgccagatc aaattcactt tatccacagt gaagagcttc ttaaacgtta cccagatctg       540
     gatgctaaag gtcgtgaacg cgaggcagcc aaagaattcg gtgcaatttt cctgatgggc       600
     attggtggta agttgtctga tgatcagtca catgatgttc gtgcaccaga ctatgatgat       660
     tggacttcgc caaacagtga tggtttcttt ggcctaaacg gtgacattat cgtatggaac       720
     cctgttttac aggacgcttt tgaaatttct tcaatgggta tccgtgttga tgcagaggcg       780
     ctgcaacgtc agcttgagct aactggtgat gaggatcgtc tgcaatatga ctggcatcag       840
     gcgctggtta aaggggatat gccgcagtcc atcggtggtg gtatcgggca gtcccgtttg       900
     gtgatgctga tgttacaaat gccacatatc ggtcaggttc agtgcggtgt ttggtcacca       960
     gaaattattg aatcagttga aggtgtgttg taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page