(data stored in ACNUC1104 zone)

EMBL: FN667742.ATPB

FN667742.ATPB        Location/Qualifiers
FT   CDS_pept        complement(33926..34750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpB"
FT                   /locus_tag="XNC1_0031"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   a, important for FO assembly"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88124"
FT                   /db_xref="GOA:D3VG34"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88124.1"
FT                   /translation="MSASGEVSTSEYISHHLRHLQLDLRTFELVNPHASGYEATFWTLN
FT                   IDSLFFSIVLGMLFLFVFRRVAVCATDGVPGKFQTAVEMIIGFVDNTVRDMYHGKSKVI
FT                   APLALTVFVWVLLMNALDLLPVDFIPYIGEHVFGLPALRIVPTADVSVTLSMALGVFVL
FT                   ILFYSIKMKGIGGFAKELTLQPFNHPLFIPINLILEGVSLLSKPISLGLRLFGNMYAGE
FT                   LIFILIAALLPVWSQWLLSLPWAIFHILIITLQAFIFMVLTIVYLSMASEEH"
     atgtctgcat caggagaagt ttcaacttcg gagtacataa gccaccatct gaggcatctt        60
     cagttggact tgcgtacctt tgagttggtc aatccccacg ctagtggtta tgaggcgacg       120
     ttttggacgt tgaacattga ctcgcttttt ttctccatcg tattagggat gttgtttcta       180
     tttgtattca gaagagtcgc ggtttgtgcc actgatggtg ttccggggaa attccagact       240
     gcagtagaaa tgataatcgg tttcgttgat aacaccgttc gtgatatgta tcacggtaag       300
     agcaaagtga tagctcctct ggctttgact gtgttcgtct gggtgttact gatgaacgca       360
     ttggacttgc tgccagtcga ttttattcct tatatcggtg aacatgtctt cggcttgcct       420
     gctttgcgca ttgttccaac cgcagatgtc agtgttacct tgtcgatggc gctcggtgtc       480
     tttgtcctca tcctgttcta cagcattaag atgaaaggaa ttggtggttt tgcgaaggag       540
     ctgacattgc agcctttcaa tcatccgcta tttattccga ttaacttaat tttggaaggg       600
     gtcagcttgc tgtctaaacc tatatcactc ggtctgcgac tgtttggtaa tatgtatgct       660
     ggtgaattga tctttattct tattgcggcg cttttgccgg tgtggtcaca gtggttactc       720
     agcctgcctt gggcgatttt ccacatactg attatcacgt tgcaagcctt tattttcatg       780
     gttctgacga ttgtttatct gtcgatggca tctgaagagc attaa                       825
//

If you have problems or comments...

PBIL Back to PBIL home page