(data stored in ACNUC1104 zone)

EMBL: FN667742.ATPF

FN667742.ATPF        Location/Qualifiers
FT   CDS_pept        complement(33108..33578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpF"
FT                   /locus_tag="XNC1_0029"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   b"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88122"
FT                   /db_xref="GOA:D3VG32"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88122.1"
FT                   /translation="MNINATILGQAFAFVLFVLFCMKYVWPPIMAAIEKRQKEITDGLA
FT                   SAERAKKNLDLAQANATDQLKKAKADAQVIIEQANKQKAQIIDDAKAEAELERNKILVQ
FT                   ANAEIEAERKRAREELRKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL"
     gtgaatatta acgcaacaat cctcggccag gccttcgcgt ttgtcctgtt tgttttgttc        60
     tgcatgaagt atgtatggcc accaatcatg gcggccattg aaaagcgtca gaaagagatt       120
     actgacggtt tggcttcagc agaacgtgcc aaaaagaacc tggacttagc gcaagccaat       180
     gcgaccgacc aactgaaaaa agcgaaagct gatgcgcaag ttatcattga gcaggctaat       240
     aaacaaaaag cccaaattat tgatgatgct aaagcagaag cagagctgga gcgtaacaaa       300
     atcttagtgc aagcgaatgc tgaaattgaa gctgaacgca aacgcgctcg tgaagagtta       360
     cgtaaacagg ttgcgatgct ggctatcgca ggtgccgaga aaattatcga acgttccgtg       420
     gatgaagctg ctaacagcga catcgttgat aaactggtcg ctgaactgta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page