(data stored in ACNUC1104 zone)

EMBL: FN667742.ATPH

FN667742.ATPH        Location/Qualifiers
FT   CDS_pept        complement(32562..33095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0004"
FT                   /gene="atpH"
FT                   /locus_tag="XNC1_0028"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   delta-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88121"
FT                   /db_xref="GOA:D3VG31"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88121.1"
FT                   /translation="MSEFATVARPYAKAAFDFAVEHQSIEHWQNMLAFIAEVTRNEQVG
FT                   ELLSGSLAPETLAKTFITLCGEQVDAHAQNFIRVMAENGRLLVLPEVFQQFIQLRASLE
FT                   STIDVEVISVSELNEQQQAKISAAMEKRLSRKVKLNCKIDKSVIAGVVIRAGDMVIDGS
FT                   IRGRLDRLTDDLQS"
     atgtctgaat ttgctacggt agctcgcccc tacgccaaag cagcttttga ctttgctgta        60
     gaacaccaat ctattgaaca ctggcagaac atgctggcgt ttattgctga ggttactcgc       120
     aatgagcagg ttggtgagct gctttccggt tcattggcac cggaaacgtt agccaaaacc       180
     tttatcaccc tttgtggtga gcaggttgat gcgcatgctc agaactttat tcgtgtaatg       240
     gcagaaaatg gtcgcttgct ggtactgcca gaagtcttcc agcaatttat ccaattgcgt       300
     gcgtcacttg aatcaaccat tgatgttgaa gtgatttctg tgtccgaact aaatgagcag       360
     cagcaggcta aaatttctgc ggcgatggaa aaacgtctgt cacgcaaagt gaagctgaat       420
     tgcaaaattg acaagtctgt tattgccggt gtggttatcc gcgcaggtga catggtgatt       480
     gatggcagta ttcgtggccg tctggatcgt ttaacagacg acttgcagtc ttaa             534
//

If you have problems or comments...

PBIL Back to PBIL home page