(data stored in ACNUC1104 zone)

EMBL: FN667742.BTUB

FN667742.BTUB        Location/Qualifiers
FT   CDS_pept        243252..245096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0057"
FT                   /gene="btuB"
FT                   /locus_tag="XNC1_0278"
FT                   /product="outer membrane porin: vitamin B12/cobalamin
FT                   transport, receptor for E colicins, bacteriophage BF23"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88366"
FT                   /db_xref="GOA:D3VH81"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88366.1"
FT                   /translation="MINKKQPFLSVISLVVFSCWSPVSIADNQDRLVVTANRFKQPISS
FT                   VLAPMTVVTREDIDRWQSNNLVDVLRRLPGVDIAQNGGLGQNSSLYVRGTNSSHTLVLV
FT                   DGIRLNQAGIMGAADFSQIPIAIVQRIEFIRGARSAVYGSDAIGGVINIITKRESRGTT
FT                   LNAGIGSNGYQNYNGSTQQKLGENTLLTAASGYTYTKGFDVIVDGKTGGYRQPDRDGFM
FT                   SKTLWLEIDHKINEQMSGFARTYGFNNRTAYDAGGIGGTDTRELFSRTYDAGLQFNQGI
FT                   YSSQLIASYSHVKDYNHAPDDGRYGKNTSLSDSKQYNVQWGNLWQVGHGAISSGVDWKR
FT                   ELVAAGSNYIPVQKSVDNTGLYLTAQQKIHDFTLEGAVRSDHHSEYDWNTTWQTGAGWE
FT                   FIDGYRLIVSYGTAFKAPTLGQLYGWGANPTLKPEKSKQWETGIEGLTGTLNWRLSAYR
FT                   NDIEQLIDYNIVTNHYRNLGQAKIRGVEWTGTMDTSIFQHQLTLQYIDPRDGNNKRLIR
FT                   RAKQQIKYQLDWEALNVDWGVTYQYIGPRHDLDYKVFPARTVKSGGVSLWDINASYPIT
FT                   DHLTIRAKIANLFDKNYETAYGYRTAGREYSLTGSYNF"
     atgataaata aaaaacagcc tttcctatct gtgatctcct tagtggtttt ttcttgctgg        60
     agtcctgttt ccattgctga taatcaagat cggctggtcg tcacagccaa tcgttttaaa       120
     caacctattt cttcagtgct ggcaccaatg acggtagtaa cacgggaaga tatcgatcgc       180
     tggcaatcca ataatctggt tgatgtttta cgccgcttgc cgggtgttga tattgcgcaa       240
     aatggtggcc ttgggcagaa ttcttcttta tatgtcaggg gaacaaattc aagtcataca       300
     ttagtgctgg tggatgggat ccgtttgaac caggctggta tcatgggagc ggctgatttt       360
     agccagatcc cgatagccat agtgcaaaga atagaattta tccggggtgc ccgttctgct       420
     gtatatggtt ctgatgctat tggcggagtc atcaacatca tcacaaaaag agaatcgcgg       480
     gggacaacgt taaatgcggg gatcggttcg aacggatatc agaattataa tggttcaacc       540
     cagcagaaac tgggtgagaa taccctatta accgcagcct caggttatac ctataccaaa       600
     gggtttgatg tgatagttga tggtaaaaca gggggatacc gccagccaga ccgtgatggt       660
     tttatgagta aaacgctgtg gttggaaata gaccataaaa taaatgaaca aatgagtgga       720
     tttgctcgga cttatggatt taataaccga accgcttatg atgctggggg tattggtggg       780
     actgatactc gcgaactatt cagccgtacc tatgatgccg gacttcaatt taatcaaggc       840
     atttactctt ctcaattaat tgccagttac agtcatgtga aagattataa tcacgctcct       900
     gacgacgggc gttatggcaa aaacaccagc ctgagtgatt ccaaacaata taatgttcaa       960
     tggggaaatc tatggcaagt tggtcatggt gcgatcagca gtggcgtgga ttggaagcga      1020
     gaattggtag ccgcaggttc taattatatt cccgtgcaaa aaagtgttga taacacaggt      1080
     ttgtatttaa cagcacagca aaaaattcat gatttcacat tggaaggcgc ggtacgctca      1140
     gatcatcatt ctgaatatga ctggaatacg acttggcaaa ctggagcggg gtgggaattc      1200
     attgatggct accgcttgat tgtctcttat ggcacggcat ttaaagcccc aacgcttgga      1260
     caattatatg gctggggggc taacccaacg ttaaaaccag aaaaaagtaa acaatgggaa      1320
     accgggattg aagggctgac tggaacactt aactggcgtt tatcggctta tcgtaatgat      1380
     attgaacagt taatagatta taacattgtg actaatcatt acagaaacct agggcaggca      1440
     aaaatcaggg gcgtggaatg gacaggaaca atggatacca gcatattcca gcatcaattg      1500
     acattacagt atattgatcc gcgtgatgga aataataaaa ggttaattcg cagagctaag      1560
     cagcagatta agtatcagtt agattgggaa gccttgaatg tcgattgggg agtcacctat      1620
     cagtatattg gcccgcgtca tgatctagac tataaggtat ttcctgcgag aacggtgaaa      1680
     tcaggcggcg tcagtttatg ggatatcaat gcctcatatc cgatcactga ccacctcaca      1740
     attcgtgcta aaatagctaa tctgtttgat aagaattatg agacagccta tggctatcgc      1800
     acggcaggaa gagaatactc cctcactggc agttacaact tctga                      1845
//

If you have problems or comments...

PBIL Back to PBIL home page