(data stored in ACNUC1104 zone)

EMBL: FN667742.CORA

FN667742.CORA        Location/Qualifiers
FT   CDS_pept        348313..349263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corA"
FT                   /locus_tag="XNC1_0415"
FT                   /product="Mg2+/Ni2+/Co2+ transport protein (Mg transport
FT                   system I) (MIT family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88492"
FT                   /db_xref="GOA:D3VI03"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D3VI03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88492.1"
FT                   /translation="MLNAFKLENNRLLRLELEEGDKLSDSMWVDLVGLGDNDRLQVQNE
FT                   LGQVLATRTELDDIEASARFFEDEDGMHVHSFFYFEDAEDHAGNSTVAFTIRDSRLYTL
FT                   RERELPAFRLYRMRARNQTMVDGNAYELLLDLFETKIEQLADVIENIYSVLESLSRVIM
FT                   EGKQGDEFDSALSNLAEQEDIGWKVRLCLMDSQRALNFLVRRARLPANQLEQAREILRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQSRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELHWTFGYPGAIGLMIAAGLAPYLYFKRKNWL"
     atgctgaacg catttaaatt agagaataat cgcctgctcc gtcttgaact tgaagaaggt        60
     gataagttat ccgactctat gtgggtagat ttggttggat tgggggataa tgatcgcctc       120
     caggtccaaa atgaacttgg acaagttctg gcaacccgca ctgaattgga tgacatcgaa       180
     gcatcggcac gtttttttga agatgaagat ggtatgcacg tccactcatt cttctatttt       240
     gaagatgctg aagaccatgc tggcaactcg acagtcgcgt ttactattcg tgacagtcgt       300
     ctctacacat tgcgagaacg tgaactccct gcatttcggt tgtaccgaat gcgcgcccgt       360
     aaccagacga tggttgatgg gaacgcctat gaactgttgc tggacttgtt cgaaaccaaa       420
     atcgaacagt tggctgatgt tattgaaaac atttacagcg tactggaatc tctgagccgg       480
     gtcattatgg aaggcaagca aggagatgaa tttgattccg cgctttctaa ccttgcagag       540
     caggaagaca ttggctggaa ggttcgcttg tgtctgatgg atagtcagcg cgccctgaac       600
     ttccttgtac gccgtgctcg tctgccggca aatcaacttg aacaggcccg tgaaatcctg       660
     cgggatatcg aatccttgct gccgcacaat gaatcgctgt ttcagaaagt taacttcctg       720
     atgcaagcgg cgatgggttt tatcaacatc gaacagagcc gcattatcaa aattttctcc       780
     gttgtttctg tggtgttcct gccgccaaca ctggtggcgt ccagctatgg aatgaacttc       840
     gaatttatgc cggagttaca ttggacattt ggttatcccg gcgctatcgg tttaatgatt       900
     gcggcaggac tcgctcccta tctctatttc aaacggaaaa attggctgta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page