(data stored in ACNUC1104 zone)

EMBL: FN667742.CPXA

FN667742.CPXA        Location/Qualifiers
FT   CDS_pept        104765..106147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0020"
FT                   /gene="cpxA"
FT                   /locus_tag="XNC1_0110"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CpxR, regulates genes involved in
FT                   folding/degrading periplasmic proteins, senses changes in
FT                   the cell envelope"
FT                   /function="16.15 : Symbiosis"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17951441; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88198"
FT                   /db_xref="GOA:D3VGA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88198.1"
FT                   /translation="MINSLTARIFAIFWLTLALVLMVALMAPKLDSRQLTPLLDSEYQQ
FT                   GNKLAKQLEEELTRYPANDLFWWLRLDRAIAQLTPPGQSLLLVTSAGNIIDINTPTRQK
FT                   QVVRNFIGQSDNADHPKKKKYGRSEILGPFSIRDGEDHYQLYFVRPAGSPQSDFINLMF
FT                   DRPFLLPAATMLISAPLLLWLAWSLAKPARKLKNAADDVAKGNLRQHPELESGPQEFLA
FT                   TGSSFNQMISALERMVTAQQRLISDISHELRTPLTRLQLATALLRRRHGESKELARIET
FT                   ETQRLDGMINDLLVLSRNQHKNELLRENIKAYDIWHDILENAKFEVEQMNKTLDIVSPP
FT                   GAWVIYCNPATLGSALENIVRNALRYSDSHIAVAFKADNQGVTITVDDDGPGVSPEDRE
FT                   QIFRPFYRTDEARDRESGGTGLGLAIVETAISQHRGWVKAEDSPLGGLRLVIWLPLHGH
FT                   GR"
     atgatcaata gcctgacagc ccgtatattc gccattttct ggctcactct tgcacttgtc        60
     ctgatggtgg ccttaatggc ccccaaactg gattcacggc aactgacacc acttctggac       120
     agtgagtatc agcaaggaaa taaactggcg aagcagctag aagaagaatt aacacgttac       180
     cctgcaaacg acctcttctg gtggttacgg ttggatcgcg ccattgctca actcacgccg       240
     ccaggccaaa gcttactcct tgttaccagt gcagggaata tcattgacat caatactccg       300
     acgcgccaaa agcaagtggt tcgtaacttt atagggcaat ctgataacgc agatcaccct       360
     aaaaagaaaa aatatggtcg ctctgaaata cttggccctt tttccatcag agatggtgaa       420
     gatcactatc aactttactt cgtaaggccg gccggcagtc cacaatcaga ttttattaac       480
     ttgatgtttg accgaccatt tttactgcca gcggcaacca tgttaatcag cgcaccttta       540
     ctattatggt tggcatggag tttggcaaaa cctgcccgta aattaaaaaa tgcagccgat       600
     gacgtcgcta aaggaaactt acggcaacac cctgaattag aatccggccc acaagaattt       660
     ttggctacag gcagcagctt caaccagatg ataagtgctc tggaaaggat ggtcactgcc       720
     caacaacggc tgatttctga tatctcccat gaactgcgta caccgctgac tcgcttacaa       780
     ttggcgacgg ccttactgcg ccgccgtcat ggtgaaagca aagaactggc acgcatcgaa       840
     acagaaaccc agcgtttaga tgggatgatt aatgacttgc tggtgctttc acgcaatcag       900
     cacaagaacg aattactccg tgaaaatatc aaagcctacg atatatggca tgacattctg       960
     gagaatgcca aattcgaagt agaacagatg aacaaaacgc tggatatcgt atctccaccc      1020
     ggtgcctggg taatttactg taaccccgcc acacttggca gcgcgctgga aaacatcgtc      1080
     cgtaatgcgc ttcgctattc tgatagccat attgcagtag cgttcaaggc agataatcaa      1140
     ggtgtcacaa ttacggttga tgatgatggg cctggagtaa gccctgaaga ccgagagcaa      1200
     atcttcagac cattttatcg gacagacgaa gcaagggaca gagagtctgg tggaaccggg      1260
     ttgggattag cgattgttga aacggcaata agtcagcatc gaggttgggt gaaagcagaa      1320
     gacagtcctt tgggaggatt acggttggtg atttggttgc cgttacatgg gcatgggagg      1380
     tag                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page