(data stored in ACNUC1104 zone)

EMBL: FN667742.CPXP

FN667742.CPXP        Location/Qualifiers
FT   CDS_pept        complement(103423..103923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxP"
FT                   /locus_tag="XNC1_0108"
FT                   /product="Periplasmic protein; Putative negative regulator
FT                   of cpxR."
FT                   /note="Evidence 1a : Function experimentally demonstrated
FT                   in the studied strain; PubMedId : 17951441; Product type pr
FT                   : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88196"
FT                   /db_xref="GOA:D3VGA6"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:D3VGA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88196.1"
FT                   /translation="MRNIAILALASMVVLRSTLALADTADTDDTPEAANPSPYCLSYEH
FT                   KRDSGYYRSDEHNYNYSYVFGGITLTEQQRQQMWDLVKKQHLHEQSIIDMRVERQKMYH
FT                   LLIEREFDEAAVRLQLEKIAEKNIDLGVEIARIRNQMYQLLTPEQKERLYKRYEGQTAQ
FT                   EMH"
     atgcgtaaca tagcaatatt ggctctagcg tcaatggttg ttcttagatc aacactggcc        60
     ttagctgaca ctgctgatac ggatgatact cctgaggctg caaacccctc gccatattgc       120
     ctgtcatatg agcataaaag ggactctggt tactaccgca gtgatgagca taattacaac       180
     tatagttatg tcttcggcgg aataacacta actgaacaac agcgccagca gatgtgggat       240
     ttagtaaaaa aacaacatct gcatgagcaa tcaataattg atatgcgggt tgaacgtcag       300
     aagatgtacc atcttttgat tgagagagag tttgatgaag ctgcggttcg gctgcaactt       360
     gagaaaatag cagaaaagaa tattgatctg ggtgtagaaa ttgcacgtat tcgcaaccag       420
     atgtaccaat tgttaacacc agagcagaaa gaacgactat acaaacgtta tgagggacaa       480
     actgctcaag agatgcactg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page