(data stored in ACNUC1104 zone)

EMBL: FN667742.DAMX

FN667742.DAMX        Location/Qualifiers
FT   CDS_pept        complement(63051..64022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0010"
FT                   /gene="damX"
FT                   /locus_tag="XNC1_0060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88148"
FT                   /db_xref="GOA:D3VG58"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88148.1"
FT                   /translation="MDELKSEKKQKTETEFKPDTSDRRPPRSKSQSNQPKLAVSRQQMM
FT                   IGVGILVLLLLIIAISSALKSPTEHEKQQSSNAAEKSIDLSGSSTLSGNEQDIGQETPS
FT                   VPATHGTDSKTHDISLPPPINSTSSQSLPPATNTGSYNQRIELPGDISDALNQQQSNIN
FT                   HSVQSNMAPLQANPTKPVLTPPIEQTKLEKVTPPKIENKGREENQPKAATKPLTNHHQT
FT                   NKKPETGASGDLLKAPANRFTLQLSSASRSDTLIAFAKKHNLSHYKVYETKRDHKTWFI
FT                   LIHGNYSSVYDAKSAISSLPAEVQAKKPWVRKLQQVQQDLKK"
     atggacgaat taaaatcaga aaagaaacaa aaaacagaaa ccgaatttaa acccgatact        60
     tctgatcgcc gccctccgcg atctaaaagc caatccaatc aacctaaact tgccgtatcc       120
     cgtcaacaaa tgatgatcgg cgttggcata ctggtacttt tgcttctgat tattgccatc       180
     agctccgcct taaaatcacc cactgagcat gagaaacagc aatcttcaaa tgcagccgaa       240
     aagagtatag atctttctgg ttcctccaca ctctctggca atgagcagga tatcggtcaa       300
     gaaactcctt ctgtaccggc aacccatggt acagacagta agacacatga catcagcctg       360
     ccgccgccga ttaacagtac ctcaagccaa agtcttcccc ccgcgaccaa taccgggagc       420
     tataaccagc gtatagaatt acccggcgat atttctgatg ctttgaacca acaacagagc       480
     aatatcaatc attctgtgca aagcaatatg gcaccgttac aagctaaccc aacaaaaccg       540
     gtgttaactc cgccgattga acagacaaaa ctagaaaaag tgacgccgcc aaaaatagaa       600
     aataagggaa gagaagaaaa tcagcccaag gcagcaacta aaccgctcac aaatcatcac       660
     cagaccaata aaaagcccga aacgggtgca agtggtgatt tactgaaagc ccctgcaaac       720
     cgattcacac tccaattaag cagcgctagc cgttccgata ccttgattgc tttcgccaaa       780
     aaacataacc tttctcacta caaggtttat gaaactaaac gcgaccataa aacatggttt       840
     atcttgattc atggtaacta cagttccgtt tatgacgcga aaagcgccat ttcttcactt       900
     ccagcggaag ttcaggccaa aaaaccgtgg gtcagaaaac tacaacaagt tcagcaagat       960
     ctgaaaaaat aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page