(data stored in ACNUC1104 zone)

EMBL: FN667742.DEF

FN667742.DEF         Location/Qualifiers
FT   CDS_pept        complement(285278..285790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0066"
FT                   /gene="def"
FT                   /locus_tag="XNC1_0350"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88432"
FT                   /db_xref="GOA:D3VHU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D3VHU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88432.1"
FT                   /translation="MSVLQVLHYPDERLRTIAKPVEKVDAEIQRIIDDMFETMYAEEGI
FT                   GLAATQVDIHQRIVVIDVSEDRKQLLVLINPELLNESGETGIEEGCLSVPEQRGFVPRF
FT                   EQIKIKALDYHGQPFELEADGLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKVEKID
FT                   RLRAKSK"
     atgtcagttt tacaagtatt acattaccca gatgaacggc ttcgcacgat agcaaagcca        60
     gtagaaaaag ttgatgcaga aatccaacgt atcattgatg atatgtttga aacgatgtat       120
     gcagaggaag gtattggcct agcagcaacg caagtcgaca ttcatcaacg aattgttgtt       180
     attgatgtct ctgaagatcg caagcaactc cttgtattga ttaaccctga gttgctcaat       240
     gaatctggtg aaacagggat agaagaaggc tgtctgtctg tgcctgaaca gcgcggattc       300
     gtcccacgtt ttgaacaaat caaaattaaa gctctagatt atcatggtca accgtttgaa       360
     ttagaagccg atggccttct ggcaatttgc attcagcatg aaatggatca tttagtcggt       420
     aaactctttg tcgattatct ttcgccattg aaacgccaac gcatccggca gaaagttgaa       480
     aaaattgacc gattaagagc caaaagcaaa taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page