(data stored in ACNUC1104 zone)

EMBL: FN667742.DNAA

FN667742.DNAA        Location/Qualifiers
FT   CDS_pept        158..1546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0001"
FT                   /gene="dnaA"
FT                   /locus_tag="XNC1_0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and housekeeping
FT                   genes"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88094"
FT                   /db_xref="GOA:D3VG04"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3VG04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88094.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVREKYINNINLLLNDFCGPEVPLLRFEVGNKPVSPNQSASQKIIADMPVATAPS
FT                   SSSVRPSWDNVKTQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNSIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMKKADENQIQLPGEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVA
FT                   RPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIR
FT                   TLSS"
     gtgtcacttt cgctttggca gcaatgtctt gcccgattgc aggatgagtt acctgccaca        60
     gaattcagta tgtggatacg accccttcag gcagaactga gtgataacac tttggctctc       120
     tatgccccca accgttttgt gttggattgg gtaagagaga aatatattaa taatatcaat       180
     ttgttattaa atgatttctg tggtcctgaa gtaccgttgc tgcgttttga agtaggcaat       240
     aaacctgtct caccaaacca gtctgcatct cagaaaatca ttgccgatat gccagtggct       300
     acggcgccgt ccagttcatc tgtacgccca agctgggaca acgtaaaaac ccagccggag       360
     ttatcctatc gttccaatgt taatcccaaa catacattcg ataactttgt tgaaggtaaa       420
     tccaaccaac tcgccagagc cgccgccagg caagttgccg ataatccggg gggcgcctac       480
     aatcccttat tcctttatgg cggaaccggg ttgggtaaaa cccatctttt gcatgctgtc       540
     ggcaacagca tcatggcacg caaagccaat gcaaaagtag tttacatgca ctctgaacgt       600
     tttgttcagg acatggtaaa agcattgcaa aacaatgcga tagaagaatt taaacgttat       660
     tatcgttccg tggatgccct gctgatcgat gatattcagt tttttgcaaa taaagagcga       720
     tcccaagaag aattctttca cacgttcaat gccctgctgg aaggtaatca acagattatt       780
     ctgacatcag accgctatcc gaaagagatc aatggcgtcg aagatcggtt aaaatcccgt       840
     tttggctggg gactcaccgt tgccatcgaa cccccggagc tggagactcg cgtcgctatt       900
     ctgatgaaga aagctgacga aaaccaaatc cagttaccgg gcgaagtggc tttcttcatt       960
     gctaaacgcc tgagatcgaa cgttcgtgag ctggaaggtg ctttgaatcg ggttattgcc      1020
     aatgccaact ttaccggccg ggcgattacc attgattttg tacgcgaagc attacgtgac      1080
     ttattggctc tacaggaaaa gctggtaacc attgataata ttcagaaaac tgtcgctgaa      1140
     tattacaaaa tcaaggtggc tgacctgctt tccaaacgcc gatctcgctc tgttgcccgt      1200
     ccgagacaaa tggcaatggc gctggcaaaa gagctgacaa atcacagctt gcctgaaatc      1260
     ggggatgcct ttggtggacg tgaccacaca actgtccttc acgcttgtcg taaaatcgag      1320
     caactgcgtg aagaaagtca tgacatcaaa gaagattttt ctaacttaat cagaacatta      1380
     tcttcctag                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page