(data stored in ACNUC1104 zone)

EMBL: FN667742.EMRD

FN667742.EMRD        Location/Qualifiers
FT   CDS_pept        186157..187311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrD"
FT                   /locus_tag="XNC1_0212"
FT                   /product="multidrug transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88300"
FT                   /db_xref="GOA:D3VH15"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3VH15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88300.1"
FT                   /translation="MLIALAAVGQMTQTIYVPVIADMAGDLGKPAGEVQRVMAAYLFSY
FT                   GLSQLFYGPLSDKVGRRPVILAGMSIFLAATTCALFAPNLLVLVIASACQGLGTGVAGV
FT                   MVRTMPRDLYTGTTLRYANSLLNMAVLVSPLVAPMIGGMIAHQFGWRSCYLFLLIWGTI
FT                   VTGFLFWYLTETRPVQTKHSPMLVSFHQLLSHGTFVAYLIMLVGGLAGVAVFEASSGVL
FT                   MGAVLGLDSLTVSILFILPIPAAFFGAWYAGREGKTFYRLMWHSVFCCLFAGILMWLPS
FT                   WFGVMNIWTLLVPAAIFFFGAGMLFPLATTGAMEPFPYLAGAAGALVGGFQNIGSGMAT
FT                   WLSAMLPQNNQSSVGMLMFSMALMILFCWLPISQRLQRQEQTIL"
     atgctgattg ccctggcggc tgtcgggcaa atgactcaaa caatttacgt acccgtcatt        60
     gccgatatgg cgggtgactt agggaaacct gcgggtgaag ttcagcgggt catggctgct       120
     tatctgtttt cttatgggct ttcacagctt ttttatggcc cattatccga taaagtgggg       180
     cgccgtccgg tgattttggc aggaatgtcc atctttctgg ccgcgacaac atgtgcacta       240
     ttcgcaccca atttattggt attagtgatt gccagcgcat gtcagggatt gggaacgggg       300
     gtcgcgggtg tgatggtgcg tacaatgcca cgggatttgt atacgggcac gacgttgcgt       360
     tatgccaata gcctgctgaa tatggccgtg ttggtcagcc ctctggtggc acctatgatt       420
     ggtggcatga ttgcccacca atttggctgg cgttcctgtt acttattttt attgatatgg       480
     gggactatcg tcactggctt tttattctgg tatttaacgg aaacgcgtcc tgttcagact       540
     aaacatagcc cgatgctagt ctctttccat caattgctct ctcatggcac ttttgtggct       600
     tacctgatta tgctggtcgg tggtttggcc ggggtggctg tttttgaagc gagcagcgga       660
     gtattgatgg gcgctgtttt ggggctggat agtctcacgg tcagtatcct gttcattttg       720
     ccgattcctg ctgcgttctt tggggcgtgg tatgcaggac gtgaaggtaa aacattttat       780
     cgtcttatgt ggcattctgt tttttgttgc ctgtttgcag gaatattaat gtggctgccc       840
     agttggttcg gggtgatgaa tatctggact ctgttagtgc ctgctgcaat cttctttttc       900
     ggtgcaggta tgttgtttcc attagcaacc acaggagcga tggagccatt tccttatttg       960
     gcaggtgcag cgggagcgct ggtcggagga tttcagaata taggttcagg catggcaaca      1020
     tggttgtcgg caatgttacc gcaaaataat caatccagtg tgggtatgct gatgttttcg      1080
     atggcgctga tgattctatt ttgttggtta cccatttctc agcggctcca gcgtcaggaa      1140
     cagacgattt tgtga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page