(data stored in ACNUC1104 zone)

EMBL: FN667742.FRDA

FN667742.FRDA        Location/Qualifiers
FT   CDS_pept        complement(550848..552644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdA"
FT                   /locus_tag="XNC1_0638"
FT                   /product="fumarate reductase, anaerobic, catalytic and
FT                   NAD/flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88709"
FT                   /db_xref="GOA:D3VJF3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88709.1"
FT                   /translation="MQTVNVDLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQSHDSHDFHFNDTVSGGDWLCEQDVVEYFVKHCPTEMIQLEQWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYSQIQRFDEHFVLDILV
FT                   DEGHARGLVALNMMEGTKVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGLGPETPLGHPENK
FT                   YMELGPRDKVSQAFWHEWRAGRTVATPRGNVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNQRCETRIKGLFAIGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAAEEAVKHIQAVKPANESALNAQFRDVEDKLNQLLNQKGNESQAKIRDDLGT
FT                   SMEEGCGIYRTPELMQKTIDKIAELKERFKRIEINDRSSVFNTDLLYTIELGFGLDVAE
FT                   CMAHSAISRKESRGAHQRLDEGCTGRDDENFLKHTLAFYNPEGAPRLEYSDVKITKSQP
FT                   AKRVYGGEAAAQEKKQKEQVND"
     gtgcaaaccg tcaatgtcga cctcgcgatt atcggagctg gtggagcagg gctacgagca        60
     gctatcgctg ccgctgaagc caatcctcag ctcaagattg ccctgatctc aaaagtttat       120
     cccatgcgca gccacacggt ggccgctgaa ggtggttcag ccgcagtcac tcagtcccat       180
     gattcccatg actttcactt caatgacacg gtatccggcg gtgactggct gtgtgaacaa       240
     gatgtggttg agtattttgt caaacattgc ccgacagaaa tgatccaact ggaacaatgg       300
     ggttgtccgt ggagccgcaa ggaagatggt tctgtgaacg tacgtcgttt cgggggcatg       360
     aaaattgagc gtacatggtt tgccgctgat aaaaccggct tccacatgct ccatacgctg       420
     ttccagactt ccctgaaata ttctcagatc caacgctttg atgaacattt tgttctcgat       480
     attctggtgg atgaaggcca cgcccgtggt ctggttgcat tgaatatgat ggaaggcaca       540
     aaagttcaga tccgtgccaa tgccgtcatt atggcaacag gcggcgcagg acgtgtctat       600
     cgttacaata ccaatggcgg catcgttacc ggtgatggta tgggtatggc attccgccac       660
     ggtgtgccat tacgtgatat ggagtttgtg caatatcacc cgacaggctt gccgggttcc       720
     ggtattttga tgaccgaagg ctgccggggt gaaggcggga ttctggtgaa caaagacggc       780
     tatcgttatc tgcaagatta tggtttaggg ccagaaaccc cgctaggaca tcctgaaaat       840
     aaatatatgg aattaggccc gcgcgataaa gtatcacagg ctttctggca tgaatggcga       900
     gcgggtcgta ctgtcgccac gccacgtggt aatgtggttt atctggattt acgccatttg       960
     ggcgagaaaa aactactcga acgtctgcca tttatctgtg aactggcaaa agcctatgtc      1020
     ggcgttgatc ccgttaaaga gccgattccc gtccgcccaa ccgcgcatta cactatgggg      1080
     ggaatcgaaa ccaaccaacg ctgtgaaact cgcatcaaag gactctttgc tatcggcgag      1140
     tgctcttctg tcggcctgca tggtgccaac cgcctgggtt ctaattctct cgcagaatta      1200
     gtcgtctttg gacgcctggc ggccgaagaa gccgttaaac atattcaggc agtgaaacct      1260
     gccaatgaga gcgcactgaa tgctcaattc cgtgatgttg aagataaact caatcaattg      1320
     ctgaaccaga aaggcaacga aagtcaggca aaaatccgcg atgatttggg aacatcaatg      1380
     gaagaaggct gcggtattta ccgtacacca gaactgatgc agaaaaccat cgacaaaatt      1440
     gccgaattga aagagcgctt caaacgtatc gaaattaacg accgttccag tgtattcaat      1500
     accgatctgc tctataccat cgaattagga tttggtctgg atgtggctga gtgcatggcg      1560
     cattctgcaa tcagccgtaa agagtcacgc ggtgcccacc agcgtcttga tgaaggttgt      1620
     accgggcgcg acgatgagaa tttcctgaag catacactgg ctttttataa tcctgaaggc      1680
     gctcctcgtc tggaatacag tgatgtgaag atcaccaaat ctcaacccgc gaagcgcgta      1740
     tatggcggcg aagcggcagc acaagagaaa aaacagaagg agcaggtgaa tgactga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page