(data stored in ACNUC1104 zone)

EMBL: FN667742.FRDC

FN667742.FRDC        Location/Qualifiers
FT   CDS_pept        complement(549711..550106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XNC1_operon0119"
FT                   /gene="frdC"
FT                   /locus_tag="XNC1_0636"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XNC1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ88707"
FT                   /db_xref="GOA:D3VJF1"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3VJF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ88707.1"
FT                   /translation="MTTKRKPYVRGMRPNWWHKLGFYRFYMLREGTSVPAVWFSLLVLY
FT                   GLFALKNGPESWAGFVAFLQNPIVLLINIITLLAALLHTKTWFELAPKALNIIVKNEKM
FT                   APGPVIKLLWAMTMIATAAILGIALLF"
     atgacaacga aacgtaaacc ttatgtgcgc ggtatgaggc ctaattggtg gcataagctg        60
     ggattttatc gcttttatat gctgcgcgaa gggacatccg ttcctgccgt ttggttcagc       120
     ctgcttgtgc tttacggttt gtttgccctg aaaaatggcc ctgaaagctg ggcgggattt       180
     gtcgctttct tgcaaaaccc cattgtgctg ctgattaata tcatcacgct actggcggct       240
     ttactgcata cgaagacatg gtttgaactg gcacccaaag cgctcaacat cattgttaaa       300
     aatgaaaaaa tggcaccggg accagttatc aagctgctat gggcaatgac gatgattgct       360
     actgccgcga ttctcggcat tgcattactt ttctaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page